https://www.usar.army.mil/Featured/Ambassador-Program/Events-News/?igtag=143d%20ESC
Ambassador Events and News - Tag 143d ESC
Official site of the U.S. Army Reserve, the federal military reserve forces of the United States.
events and newsambassadortagesc
https://www.143aw.ang.af.mil/News/Article-Display/Article/451693/team-rhody-is-mission-ready/
Team Rhody is Mission Ready 143d Airlift Wing Article Display
This summer the 143d Airlift Wing joined forces with the 107th Airlift Wing and the 914th Air Reserve Wing, both of Niagara, New York, to form the 125th Air...
mission readyteamrhodyairliftwing
https://www.143aw.ang.af.mil/News/Article-Display/Article/868777/rock-solid-warrior-airman-1st-class-jared-kearns/
Rock Solid Warrior: Airman 1st Class Jared Kearns 143d Airlift Wing Article Display
https://www.143aw.ang.af.mil/News/Photos/igphoto/2000906239/
143d Mission Support Group Commander Promoted to Colonel
Colonel Anthony Hamel is pinned by his wife Carol and his children Sophia, Grace, Antonio and Andrew. National Guard photo by Master Sgt Janeen Miller
mission supportgroup commanderpromoted tocolonel
https://www.143aw.ang.af.mil/News/Photos/igphoto/2000916995/
CERFP Capabilities Demonstrated by Members of the 143d Airlift Wing
Members of the 143d Airlift Wing involved in the Region 1 Chemical, Biological, Radiological, Nuclear, High Yield Explosive Enhanced Response Force Package...
members of thecapabilitiesdemonstratedairliftwing
https://www.143aw.ang.af.mil/News/Photos/igphoto/2000917007/
CERFP Capabilities Demonstrated by Members of the 143d Airlift Wing
Members of the 143d Airlift Wing involved in the Region 1 Chemical, Biological, Radiological, Nuclear, High Yield Explosive Enhanced Response Force Package...
members of thecapabilitiesdemonstratedairliftwing
https://www.usar.army.mil/ARBWC/?igtag=143d%20Sustainment%20Command%20(Expeditionary
Army Reserve Best Squad - Tag 143d Sustainment Command (Expeditionary
Army Reserve Best Warrior Competition. Held annually to determine the top NCO and Soldier in the United Stats Army Reserve. The winners qualify to compete at...
army reservebestsquadtagsustainment
https://www.usar.army.mil/News/Images/igphoto/2001886409/
143d ESC Soldiers prepare to deploy
escsoldierspreparedeploy
https://www.usar.army.mil/News/Images/igphoto/2001917898/
With Honor and Hospitality: 143d ESC supports Military Appreciation Weekend at Westgate Resort
https://www.usar.army.mil/News/Images/igphoto/2001917896/
With Honor and Hospitality: 143d ESC supports Military Appreciation Weekend at Westgate Resort
Standing in front of a Light Medium Tactical Vehicle, U.S. Army Sgt. Larry J. Sistante, unit supply specialist, Mission Support Element, Headquarters and...
https://www.143aw.ang.af.mil/News/Article-Display/Article/1489920/a-change-of-command-for-rhode-island-air-national-guard-unit/
A Change of Command for Rhode Island Air National Guard unit 143d Airlift Wing Article Display
Col. Michael A. Comstock, who had been the vice commander for the Quonset Airport-based unit since 2016, took over command from Col. Daniel Walter.,
https://www.143aw.ang.af.mil/News/Article-Display/Article/868779/143d-airlift-wing-participates-in-exercise-shared-accord-2013-port-elizabeth-so/
143d Airlift Wing Participates in Exercise Shared Accord 2013, Port Elizabeth, South Africa 143d...
Airmen from the 143d Airlift Wing, Rhode Island Air National Guard, departed July 10, 2013 aboard a C-130J "Super Hercules" on a mission to South Africa. The...
https://www.143aw.ang.af.mil/News/Photos/igphoto/2000906240/
143d Mission Support Group Commander Promoted to Colonel
Colonel Arthur Floru, Commander, 143d Airlift Wing, Lieutenant Colonel Anthony Hamel, Commander, 143d Mission Support Group, and LtCol Hamel's family stand for...
mission supportgroup commanderpromoted tocolonel
https://ovpod.libsyn.com/case-143d-neil-stonechild
Occultae Veritatis Podcast - OVPOD: Case #143d: Neil Stonechild
Occultae Veritatis Podcast Case #143d: Neil Stonechild Part 4 of 4. We go over the case, pull the previous three episodes together, and get angry. Join us as...
veritatispodcastcaseneil
https://www.143aw.ang.af.mil/News/Article-Display/Article/451700/rhode-island-national-guard-open-house-and-air-show-wins-prestigious-award/
Rhode Island National Guard Open House and Air Show Wins Prestigious Award 143d Airlift Wing ...
The Rhode Island National Guard (RING) Air Show was recognized as the 2008 recipient of the prestigious Dick Schram Memorial Community Relations Award during...
https://www.143aw.ang.af.mil/News/Photos/igphoto/2001728595/
143d Airlift Wing Uses Combat Offload Method B Technique
Airmen from the 143d Airlift Wing's Maintenance Group, Operations Group and Logistics Readiness Squadron work together to plan and complete the offload of a...
method bairliftwingusescombat
https://www.usar.army.mil/News/News-Display/Article/1523070/143d-esc-supports-military-appreciation-weekend-at-westgate-resort/
143d ESC supports Military Appreciation Weekend at Westgate Resort U.S. Army Reserve ...
Four Soldiers from Mission Support Element, 143d Sustainment Command (Expeditionary), joined thousands of service members, veterans and their families who...
https://www.usar.army.mil/News/Images/?igtag=143d%20ESC
Images - Tag 143d ESC
The official source for Army Reserve imagery. All photographs are considered public domain and cleared for release. If you would like to republish please give...
imagestagesc
https://www.usar.army.mil/YearInPhotos/igphoto/2003138372/
143d Sustainment Command (Expeditionary) promotion ceremony
1st Lt. Bianka Gonzalez, a Quartermaster officer with the 143d Expeditionary Sustainment Command, stands in front of the formation after being promoted to the...
sustainmentcommandexpeditionarypromotionceremony
https://www.143aw.ang.af.mil/News/Article-Display/Article/451699/keeping-it-in-the-family/
Keeping it in the Family 143d Airlift Wing Article Display
David Buckley, son of the late LtCol (ret) David Buckley, was sworn in as a UPT candidate here at the Quonset Air National Guard Base, on Saturday, 6 December...
keeping it in the familyairliftwingarticledisplay
https://www.143aw.ang.af.mil/News/Article-Display/Article/451694/hard-work-pays-off-in-more-ways-than-one/
Hard Work Pays Off in More Ways than One! 143d Airlift Wing Article Display
The National Guard Association of Rhode Island announced that through the efforts of the 2009 Rhode Island National Guard Open House Air Show held here in June...
hard work pays offmore ways than one