https://evolved.marketing/aesthetic-practices/
Aesthetic Practice Marketing Agency | Medspa Digital Marketing | Evolved
Apr 27, 2026 - Digital marketing for aesthetic practices and medspas — patient acquisition, visual content strategy, reputation management, and consultation booking systems.
aesthetic practice marketingagencymedspadigitalevolved
https://www.autopatient.com/
#1 Aesthetic Practice Marketing Agency - autoPatient
Built specifically for the needs of aesthetic practice marketing agency, autoPatient offers a true all-in-one clinic marketing and management software that's...
aesthetic practice marketingagency
https://digimax.dental/which-domain-is-best-suited-for-my-dental-or-aesthetic-practice/
Which domain is best suited for my dental or aesthetic practice? - Dental Marketing by Digimax
We often get asked, “Which domain name is best for my practice?”. Before we dive deeper, I would like to clarify for those who may not know a domain name is a...
aesthetic practice marketingdomainbestsuiteddental