https://www.industriejobs.de/Job/Senior-Digital-ASIC-Design-Engineer-Synthesis-m-f-d.1961366655.html
Senior Digital ASIC Design Engineer Synthesis (m/f/d)
Senior Digital ASIC Design Engineer Synthesis (m/f/d), Advantest Europe GmbH auf dem Stellenmarkt von www.industriejobs.de
asic designm fseniordigitalengineer
https://jobs.anitab.org/companies/nvidia/jobs/57316963-senior-asic-design-engineer-circuits
Senior ASIC Design Engineer - Circuits @ NVIDIA | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
asic designseniorengineercircuitsnvidia
https://download.atlantis-press.com/proceedings/wartia-17/25885633
An Efficient Timing Optimization Method in ASIC Design | Atlantis Press
In the physical design of integrated circuits, the traditional clock tree synthesis is difficult to meet the timing convergence requirements at high frequency....
asic designefficienttimingoptimizationmethod
https://careers.qualcomm.com/careers/job/446706316213-asic-design-engineer-hardware-security--san-diego-california-united-states-of-america?domain=qualcomm.com
ASIC Design Engineer (Hardware Security) | Qualcomm
Bachelor's degree in electrical engineering, or related Sciences 6+ years of experience in ASIC design Experience and understanding of ASIC design flow:...
asic designhardware securityengineerqualcomm
https://www.icsense.com/expertises/low-power/
Low Power ASIC Design - ICsense
low powerasic design
https://jobs.apple.com/nl-nl/details/200620219-3956/cellular-asic-design-engineer
Cellular ASIC Design Engineer - Vacatures bij Apple (NL)
Solliciteer naar een baan als Cellular ASIC Design Engineer bij Apple. Lees meer over deze functie en ontdek of het iets voor jou is.
asic designcellularengineervacaturesbij
https://anysilicon.com/?categ=peripheral-controller
Find ASIC design companies, IP Cores and service providers - AnySilicon
Mar 2, 2020 - The quickest way to find any ASIC design companies, IP Cores and service providers for ASIC design, verification, packaging, testing, validation and turnkey...
asic design companiesip coresservice providersfind
https://getsetjobs.com/job-tag/asic-design/
ASIC Design - Get Set Jobs
asic designget setjobs
https://www.jobinhoreca.com/job/viewjob/1618254/principal-rfmmwave-asic-design-engineer.html?
Principal RF/mmWave ASIC Design Engineer - Tusk IC via JobInHoreca
Please send your CV to careers@tusk-ic.com Work environment Tusk IC is a fabless millimeter wave (mmWave) IC design company, located in Antwerp, Belgium....
asic designprincipalrfmmwaveengineer
https://careers.ovalpark.com/companies/swir-vision-systems/jobs/65485714-principal-asic-design-engineer
Principal ASIC Design Engineer @ SWIR Vision Systems | Oval Park Job Board
Search job openings across the Oval Park network.
asic designvision systemsoval parkprincipalengineer
https://www.icalps.com/blog/asic-design/
ASIC Design Insights - IC'ALPS
This blog focuses on the design and supply of custom integrated circuits. Whether you are a beginner or a veteran in the semiconductor playing field.
asic designinsightsalps
https://www.asictronix.com/
ASICtronix: ASIC design services & Verification - ASIC
Whatever ASIC design services you require, we will deliver a solution that addresses the unique problem you are trying to solve. Contact us to get a quote.
asic design servicesverification
https://www.ingenieurprofile.de/job/16508695/senior-analog-asic-design-engineer-mfd
Senior Analog ASIC Design Engineer (m/f/d) | Advantest Europe GmbH
Finden Sie dieses Stellenangebot auf Ingeineurprofile.de - Senior Analog ASIC Design Engineer (m/f/d)
asic designm fsenioranalogengineer
https://www.design-reuse.com/news/202512047-faraday-and-arrow-electronics-enter-asic-design-and-distribution-partnership-agreement/
Faraday and Arrow Electronics Enter ASIC Design and Distribution Partnership Agreement
Design And Reuse - Catalog of IP Cores and Silicon on Chip solutions for IoT, Automotive, Security, RISC-V, AI, ... and Asic Design Platforms and Resources
arrow electronicsasic designdistribution partnershipfaradayenter
https://www.semimedia.cc/3712.html
ASIC design company Faraday strengthens cooperation with Samsung - SemiMedia
Jan 2, 2019 - ASIC and silicon IP provider Faraday and Samsung started the cooperation of advanced process projects last year. At that time, Faraday already had orders for...
asic designcompanyfaradaycooperationsamsung
https://www.gedec.it/competences/integrated-circuit-design/full-asic-design/
Full ASIC Design - GEDEC - Genova Design Center
GEDEC (GEnova Design Center) is an independent electronic system and integrated circuit design house, mainly focused in advanced electronic and...
asic designfullgenovacenter
https://www.emft.fraunhofer.de/en/research-development/circuit-design/high-voltage-driver-sensor-actuator.html
High Voltage ASIC Design for MEMS
Low-power, area-efficient high-voltage application specific integrated circuits (HV ASIC) are crucial in order to leverage the extreme miniaturization...
high voltageasic designmems
https://jobs.longjourney.vc/companies/spacex/jobs/77076246-manager-asic-design-engineering-starshield-silicon
Manager, ASIC Design Engineering (Starshield Silicon) @ SpaceX | Long Journey Ventures Job Board
Search job openings across the Long Journey Ventures network.
long journey venturesasic design
https://real.naruayshop.com/posts/113225
ASIC Design Starts Industry Competitive Landscape and Key Players
The global semiconductor ecosystem is undergoing a rapid transformation fueled by the demand for customized, high-performance integrated circuits across...
asic designcompetitive landscapestartsindustrykey
https://techlabssemi.com/
Techlabs Semiconductor - Leading Chip Design Companies in India | ASIC, FPGA, SoC & Semiconductor...
Techlabs Semiconductor is among the top chip design companies in India, delivering ASIC, FPGA, SoC, and semiconductor engineering solutions. Trusted for...
companies in indiatechlabs semiconductorchip designleading