https://www.brooklynspeaks.net/
BrooklynSpeaks | Atlantic Yards must work for Brooklyn
atlantic yardsmustworkbrooklyn
https://atlanticyardsreport.blogspot.com/2008/03/yes-atlantic-yards-is-source-of.html
Yes, Atlantic Yards is the source of the "bloggiest" claim
On the Brian Lehrer Live show taped Wednesday, guest Steven Berlin Johnson, co-founder of Outside.in, explicitly acknowledged that Atlantic...
atlantic yardsthe sourceyesclaim
https://citylimits.org/behind-atlantic-yards-housing-deal-some-big-shifts/
Behind Atlantic Yards Housing Deal, Some Big Shifts - City Limits
Jan 16, 2015 - Affordability in next two buildings skews to households earning six figures; pattern suggests more all market-rate towers; new emphasis on larger units.
atlantic yardsbehindhousingdealbig
https://atlanticyardsreport.blogspot.com/2022/04/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://gowanuslounge.blogspot.com/2006/05/atlantic-yards-propaganda-backlash.html
The Gowanus Lounge: Atlantic Yards Propaganda Backlash
atlantic yardsgowanusloungepropagandabacklash
https://atlanticyardsreport.blogspot.com/2018/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2007/07/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2011/08/errant-trucks-around-atlantic-yards.html
Errant trucks around Atlantic Yards site represent yet more violations of...
Yesterday morning, I cited , via Atlantic Yards Watch, continuing violations of environmental/truck rules at the Atlantic Yards site. Last...
atlantic yardserranttrucksaround
https://www.opednews.com/populum/page.php?f=Atlantic-Yards--Roll-Out-by-Carola-Von-Hoffman-100506-313.html
Article: Atlantic Yards-- Roll Out the Dough, Land Grab to Go | OpEdNews
Article: Atlantic Yards-- Roll Out the Dough, Land Grab to Go - I love the smell of eminent domain abuse in the morning. It smells like land grabs and...
atlantic yardsroll outthe dough
https://www.bobguskind.com/2009/02/27/atlantic-yards-1-court-rules-for-state-on-eis-litigation/
Atlantic Yards #1: Court Rules for State on EIS Litigation
atlantic yardscourt rulesstateeislitigation
https://atlanticyardsreport.blogspot.com/2009/07/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2025/05/would-mayor-cuomo-boost-potential.html
Would "Mayor" Cuomo Boost Potential Cirrus Deal for Atlantic Yards? (Substack)
Would "Mayor" Cuomo Boost Potential Cirrus Deal for Atlantic Yards? ( link ) Candidate backs construction union partnership with "mission-dr...
atlantic yardswouldmayorboostpotential
https://atlanticyardsreport.blogspot.com/2017/05/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2007/10/another-atlantic-yards-flier-another.html
Another Atlantic Yards flier, another avoidance of scale
It is, by my count, at least the sixth slick flier developer Forest City Ratner has distributed to Brooklynites since the Atlantic Yards pla...
atlantic yardsanotherflieravoidancescale
https://atlanticyardsreport.blogspot.com/2007/08/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2009/09/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://urbanomnibus.net/2011/08/atlantic-yards-watch-tracking-daily-impacts/
Atlantic Yards Watch: Tracking Daily Impacts - Urban Omnibus
Aug 9, 2024 - While the overall response to Atlantic Yards may seem a salutary example of citizen media, using widely available innovations like blogs and YouTube, it also...
atlantic yardswatchtrackingdailyimpacts
https://atlanticyardsreport.blogspot.com/2011/07/as-atlantic-yards-district-service.html
As Atlantic Yards District Service Cabinet meeting approaches Thursday, Atlantic Yards Watch keeps...
I got an email this morning from a Prospect Heights resident telling me--without detail--that construction on the Atlantic Yards site was co...
atlantic yardsdistrictservice
https://www.campingcomfortably.com/opera.html
Atlantic Yards OPerA
atlantic yardsopera
https://www.brooklynspeaks.net/node?page=20&ref=bklyner.com
BrooklynSpeaks | Atlantic Yards must work for Brooklyn
atlantic yardsmustworkbrooklyn
https://atlanticyardsreport.blogspot.com/2016/09/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://foundinbrooklyn.blogspot.com/2008/05/atlantic-yards-rally.html
Found in Brooklyn: The Atlantic Yards Rally
I was a good concerned Brooklyn citizen for the people and went to the Atlantic Yards Rally today. I heard a lot of great, passionate speech...
the atlanticfoundbrooklynyardsrally
https://pacificlegal.org/atlantic-yards-cert-petition-filed/
Atlantic Yards Cert Petition Filed
Apr 2, 2008 - The property owners in the Atlantic Yards eminent domain case in New York have filed a petition for certioari in the United States Supreme Court. How Appealing...
atlantic yardscert petitionfiled
https://atlanticyardsreport.blogspot.com/2011/01/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://queenscrap.blogspot.com/2009/12/atlantic-yards-headscratcher.html?m=0
Queens Crap: Atlantic Yards headscratcher
From Atlantic Yards Report : A master closing involving the Metropolitan Transportation Authority, Empire State Development Corporation (ESD...
atlantic yardsqueenscrap
https://foundinbrooklyn.blogspot.com/2008/04/atlantic-yards-rally-may-3rd.html
Found in Brooklyn: Atlantic Yards Rally * May 3rd
The Council of Brooklyn Neighborhoods, Develop Don't Destroy Brooklyn and Brooklyn Speaks are organizing a massive protest to call for no m...
atlantic yardsfoundbrooklynrallymay
https://www.akrf.com/projects/atlantic-yards-pacific-park/
Atlantic Yards & Pacific Park
Dec 5, 2025 - The redevelopment of a 22-acre underutilized area in Downtown Brooklyn is bringing a mix of uses and benefits to the local community.
atlantic yardspacificpark
https://www.brooklynspeaks.net/
BrooklynSpeaks | Atlantic Yards must work for Brooklyn
atlantic yardsmustworkbrooklyn
https://atlanticyardsreport.blogspot.com/2010/06/court-of-appeals-citing-precedent-in.html
Court of Appeals, citing precedent in Atlantic Yards case, overturns lower court ruling blocking...
In less than four weeks after a contentious oral argument, the state Court of Appeals brought an unsurprising end to the Cinderella story th...
court of appeals
https://atlanticyardsreport.blogspot.com/2009/02/dddb-cbn-good-jobs-ny-clergy-oppose.html
DDDB, CBN, Good Jobs NY, clergy oppose stimulus for Atlantic Yards
First, BrooklynSpeaks and NYPIRG's Straphangers Campaign issued statements Tuesday opposing the awarding of federal stimulus funds for Atla...
good jobscbnny
https://atlanticyardsreport.blogspot.com/2008/03/yes-atlantic-yards-is-source-of.html
Yes, Atlantic Yards is the source of the "bloggiest" claim
On the Brian Lehrer Live show taped Wednesday, guest Steven Berlin Johnson, co-founder of Outside.in, explicitly acknowledged that Atlantic...
atlantic yardsthe sourceyesclaim
https://citylimits.org/behind-atlantic-yards-housing-deal-some-big-shifts/
Behind Atlantic Yards Housing Deal, Some Big Shifts - City Limits
Jan 16, 2015 - Affordability in next two buildings skews to households earning six figures; pattern suggests more all market-rate towers; new emphasis on larger units.
atlantic yardsbehindhousingdealbig
https://atlanticyardsreport.blogspot.com/2011/05/good-corporate-citizen-profile-of.html
Good corporate citizen? Profile of Ratner in the Forward quotes Atlantic Yards opponents and...
Here's some news unmentioned in The Real Deal's sycophantic profile of Bruce Ratner last week: as headlined in the Forward, the weekly new...
good corporate citizen
https://atlanticyardsreport.blogspot.com/2022/04/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://gowanuslounge.blogspot.com/2006/05/atlantic-yards-propaganda-backlash.html
The Gowanus Lounge: Atlantic Yards Propaganda Backlash
atlantic yardsgowanusloungepropagandabacklash
https://brokelyn.com/might-maybe-allegedly-see-affordable-housing-atlantic-yards-soon/
We might live to see affordable housing at Atlantic Yards
Jun 27, 2014 - Take it with a grain of salt, but Atlantic Yards has a new, earlier deadline and two buildings will now total 600 units of affordable housing exclusively.
see affordable housingmightliveatlanticyards
https://atlanticyardsreport.blogspot.com/2023/01/from-landscape-architect-balsley-useful.html
From landscape architect Balsley, a useful massing model of Atlantic Yards/Pacific Park buildout...
via TF Cornerstone I wrote yesterday about how landscape designer swa/Balsley's master plan design for Pacific Park Brooklyn, first unveil...
https://atlanticyardsreport.blogspot.com/2018/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2010/04/brief-hearing-on-last-atlantic-yards.html
Brief hearing on last Atlantic Yards case is anticlimactic; more motions to be filed, with argument...
Though certainly a vigorous argument over the merits of the last Atlantic Yards case to face an initial hearing (as opposed to an appeal) m...
https://atlanticyardsreport.blogspot.com/2010/11/amanda-burden-open-space-award-sets-new.html
The Amanda Burden Open Space Award sets a new standard; could the Atlantic Yards plaza be a...
The Urban Land Institute (ULI), a developer-led organization, this year gave its first Amanda Burden Urban Open Space Award , named for and ...
https://atlanticyardsreport.blogspot.com/2023/05/the-future-of-atlantic-yardspacific.html
The future of Atlantic Yards/Pacific Park: extend, pretend, and find some new friends? New York...
Way back in December 2010, in my "Anatomy of a Shady" deal series on the first--of three--efforts to raise cheap capital for Atlantic Yards,...
https://atlanticyardsreport.blogspot.com/2007/07/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2011/08/errant-trucks-around-atlantic-yards.html
Errant trucks around Atlantic Yards site represent yet more violations of...
Yesterday morning, I cited , via Atlantic Yards Watch, continuing violations of environmental/truck rules at the Atlantic Yards site. Last...
atlantic yardserranttrucksaround
https://www.opednews.com/populum/page.php?f=Atlantic-Yards--Roll-Out-by-Carola-Von-Hoffman-100506-313.html
Article: Atlantic Yards-- Roll Out the Dough, Land Grab to Go | OpEdNews
Article: Atlantic Yards-- Roll Out the Dough, Land Grab to Go - I love the smell of eminent domain abuse in the morning. It smells like land grabs and...
atlantic yardsroll outthe dough
https://atlanticyardsreport.blogspot.com/2019/03/will-greenland-sell-more-of-atlantic.html
Will Greenland sell more of Atlantic Yards/Pacific Park? Unclear, but Chinese firms face changing...
As I wrote in April 2015, surveying the "the vigorous (and potentially precarious) ambitions of the new Atlantic Yards majority owner," it'...
https://www.bobguskind.com/2009/02/27/atlantic-yards-1-court-rules-for-state-on-eis-litigation/
Atlantic Yards #1: Court Rules for State on EIS Litigation
atlantic yardscourt rulesstateeislitigation
https://atlanticyardsreport.blogspot.com/2015/04/from-latest-atlantic-yardspacific-park.html
From the latest Atlantic Yards/Pacific Park Construction Alert: noisy overnight work coming Thursday
According to the latest two-weeks Atlantic Yards/Pacific Park Construction Update, dated April 13 but circulated today at 1:42 pm by Empire ...
https://atlanticyardsreport.blogspot.com/2025/07/does-pacific-park-conservancy-which.html
Does the Pacific Park Conservancy, which governs Atlantic Yards open space, have Directors from...
As I've written ( link ), questions persist about the oversight of "Pacific Park," the 2.7-acre (for now) open space on the southeast block ...
https://atlanticyardsreport.blogspot.com/2014/12/the-barclays-center-moves-in-place-from.html
The Barclays Center moves (in place) from Atlantic Yards to Pacific Park
It's a small piece of carelessness, but it's a sign of the uneasy, incomplete transition . Yesterday, I noticed that the Barclays Center T...
barclays centerin place
https://atlanticyardsreport.blogspot.com/2025/12/complex-stakes-in-atlantic-yards.html
Brooklyn Ascending everywhere? In complex Atlantic Yards ownership structure, at least ten LLCs...
I recently wrote : Does anyone, outside of the principals, know the ownership stakes in Brooklyn Ascending Land Co., LLC, the legal entity t...
https://atlanticyardsreport.blogspot.com/2009/07/
Atlantic Yards/Pacific Park Report
This watchdog blog, by journalist Norman Oder, covers the project to build the Barclays Center arena and 15-16 towers at a crucial site in Brooklyn. Dubbed...
atlantic yardspacific parkreport
https://atlanticyardsreport.blogspot.com/2025/05/would-mayor-cuomo-boost-potential.html
Would "Mayor" Cuomo Boost Potential Cirrus Deal for Atlantic Yards? (Substack)
Would "Mayor" Cuomo Boost Potential Cirrus Deal for Atlantic Yards? ( link ) Candidate backs construction union partnership with "mission-dr...
atlantic yardswouldmayorboostpotential
https://atlanticyardsreport.blogspot.com/2020/03/jobs-housing-and-hope-atlantic-yards.html
"Jobs, housing, and hope": an Atlantic Yards reference in the iShe's Gotta Have It/i reboot
Nola Darling (DeWanda Wise) and Mars Blackmon (Anthony Ramos) New York State on Pause report: I just got around to watching Season Tw...
https://atlanticyardsreport.blogspot.com/2013/09/from-latest-atlantic-yards-construction.html
From the latest Atlantic Yards Construction Alert: Dean Street closure Sept. 9, periodic relocation...
According to the latest two-week Atlantic Yards Construction Alert (bottom), dated Sept. 2 and distributed yesterday by Empire State Develop...
https://atlanticyardsreport.blogspot.com/2013/11/lawsuit-challenging-dobs-approval-of.html
Lawsuit challenging DOB's approval of Atlantic Yards modular plan set for Dec. 17 court hearing;...
Remember that lawsuit challenging the Atlantic Yards modular plan? ENR New York reported yesterday, Oral Arguments Set for December in SHoP...
https://atlanticyardsreport.blogspot.com/2012/04/atlantic-yards-down-memory-hole-gehry.html
Atlantic Yards down the memory hole: Gehry, asked about issues of scale, grudgingly admits, "Yeah,...
An exchange between architecture critic Paul Goldberger and architect Frank Gehry, during an interview April 12 at Yale University , suggest...