Sponsor of the Day:
Jerkmate
https://www.awardspace.com/kb/custom-error-documents/
How to Configure Custom Error Documents - AwardSpace.com
configure customerrordocumentsawardspace
https://www.awardspace.com/create-website-free/
Create a Website for Free - AwardSpace.com
Mar 5, 2026 - Create a website for free with AwardSpace: choose a free subdomain, install WordPress or Joomla with one-click, or use the free Website Builder.
createfreeawardspace
https://www.awardspace.com/kb/my-website-looks-different-on-different-browsers/
Why does my website look different on different browsers? - AwardSpace.com
Feb 28, 2024 - The problem comes from the fact that different browsers parse HTML and CSS differently. You can search on the internet for some tips on how to make your site...
look differentbrowsersawardspace
https://www.awardspace.com/kb/how-to-browse-my-completed-orders/
How to Browse My Completed Orders - AwardSpace.com
Read how to check your orders and invoices within the AwardSpace hosting panel.
browsecompletedordersawardspace
https://www.awardspace.com/use-cases/small-business-website/
Small Business Website - AwardSpace.com
Mar 5, 2026 - Grow Your Small Business. Launch your site easily with unlimited storage, traffic, a site builder, and multi-layered security features.
small businessawardspace
https://www.awardspace.com/kb/how-to-contact-the-technical-support-team/
How to Contact the Technical Support Team - AwardSpace.com
Jul 13, 2024 - Discover how to reach AwardSpace's technical support team for assistance with web hosting issues, available 24/7 through multiple channels including live chat,...
technical support teamawardspace
https://www.awardspace.com/wordpress-tutorials/create-a-wordpress-website/
How to Create a WordPress Website - The Full Guide | AwardSpace.com
Feb 28, 2024 - If you are considering getting your idea online, this is the only guide you'll need on how to create a website with WordPress. Check it out!
full guidecreatewordpressawardspace
https://www.awardspace.com/kb/domain-not-working/
I have hosted my domain, but it is not working. Why? - AwardSpace.com
Feb 27, 2024 - In this article we will cover the reason for which your domain is not working after you have hosted it in your account.
hosteddomainworkingawardspace
https://www.awardspace.com/kb/how-to-check-my-auto-renewals/
How to Check My Auto Renewals - AwardSpace.com
Learn how to check which of your AwardSpace hosting services will renew automatically.
auto renewalscheckawardspace
https://www.awardspace.com/kb/correct-settings-establish-ftp-connection/
The Correct Settings to Establish an FTP connection? - AwardSpace.com
ftp connectioncorrectsettingsestablishawardspace
https://www.awardspace.com/freebies/
Freebies - AwardSpace.com
freebiesawardspace
https://www.awardspace.com/kb/how-to-check-if-selinux-is-enabled-in-mediawiki/
How to Check If SELinux Is Enabled in MediaWiki - AwardSpace.com
Jan 6, 2025 - Learn how to check if SELinux is enabled in MediaWiki, understand its modes, and how to configure SELinux security, and troubleshoot issues.
mediawiki awardspacecheckselinuxenabled
https://www.awardspace.com/kb/personalize-wordpress-theme/
Personalize WordPress Theme - AwardSpace.com
Mar 2, 2024 - Unlock the full potential of your WordPress site by personalizing your theme. Make your WordPress website your own.
wordpress theme awardspacepersonalize
https://www.awardspace.com/help/
Help - AwardSpace.com
helpawardspace
https://www.awardspace.com/kb/document-redirection/
How to set up document redirection - AwardSpace.com
Apr 15, 2024 - Effortlessly reroute visitors with Awardspace's .htaccess Generator. Explore how to set up document redirection for seamless transitions.
setdocumentredirectionawardspace
https://www.awardspace.com/kb/delete-a-wordpress-category/
Delete a WordPress Category - AwardSpace.com
Feb 26, 2024 - Learn the quick and easy steps to efficiently delete WordPress categories without affecting your content.
wordpress categorydeleteawardspace
https://www.awardspace.com/signup/?id=4000&type=semi
Signup - AwardSpace.com
Oct 2, 2025 - You can sign up for Shared Hosting, FREE Web Hosting, or Semi-Dedicated Hosting and choose a domain, SSL Certificate, or VPS service as part of the process.
signup awardspace
https://www.awardspace.com/kb/firessh/
How to connect through SSH using FireSSH? - AwardSpace.com
connectsshusingawardspace
https://www.awardspace.com/kb/how-to-check-my-hosting-limits/
How to Check My Hosting Limits - AwardSpace.com
Learn how to check the hosting limits of your account via the handy AwardSpace hosting dashboard. All you need is a minute and a few clicks.
checkhostinglimitsawardspace
https://www.awardspace.com/kb/email-settings/
Email Account Settings | AwardSpace | Knowledge Base
Feb 27, 2024 - In this tutorial, we're going to explain how to find your email account settings inside AwardSpace hosting control panel.
awardspace knowledge baseemail accountsettings
https://www.awardspace.com/kb/how-do-my-affiliates-get-paid/
How do my affiliates get paid? - AwardSpace.com
Oct 24, 2024 - Herea are the payment methods that are available for the affiliates of your white-label web hosting store.
affiliates get paidawardspace
https://www.awardspace.com/kb/why-in-phpmyadmin-there-is-an-error-message-you-have-no-privileges/
Why in phpMyAdmin there is an error message "You have no privileges"? - AwardSpace.com
Feb 28, 2024 - The only privileges that your database does not have are CREATE DATABASE. If you wish to add new databases, please use the Database Manager.
error messagephpmyadminprivilegesawardspace
https://www.awardspace.com/typo3-hosting/
Typo3 Hosting - AwardSpace.com
Mar 5, 2026 - TYPO3 Hosting Optimized hosting with TYPO3 auto-installer, unlimited resources, Free SSL/HTTPS, data backup, and a 30-day money-back guarantee.
typo3 hostingawardspace
https://www.awardspace.com/kb/how-can-i-export-a-database-using-phpmyadmin/
How can I export a database using phpMyAdmin? - AwardSpace.com
database usingexportphpmyadminawardspace
https://www.awardspace.com/kb/how-to-install-extensions-on-vtiger/
How to Install Extensions on Vtiger - AwardSpace.com
Read how to install Vtiger Extensions quickly and with only a few clicks here and there without using any code.
vtiger awardspaceinstallextensions
https://www.awardspace.com/kb/establish-connection-dreamweaver-ftp/
How to Establish Connection with Dreamweaver FTP? - AwardSpace.com
Feb 28, 2024 - Use the following Dreamweaver FTP settings: Access: FTP FTP Host: yourdomainname.com Host Directory: Leave it blank or write ‘/’ Login: Your FT Username...
establish connectiondreamweaverftpawardspace
https://www.awardspace.com/kb/access-error-logs/
Access and Error Logs Manager | AwardSpace.com
Feb 27, 2024 - In this article you will find detailed instructions about how to use the AwardSpace Control Panel's Access and Error Logs Manager.
error logsmanager awardspaceaccess
https://www.awardspace.com/signup/?id=1603&type=shared&promo_code=1usd
Signup - AwardSpace.com
Oct 2, 2025 - You can sign up for Shared Hosting, FREE Web Hosting, or Semi-Dedicated Hosting and choose a domain, SSL Certificate, or VPS service as part of the process.
signup awardspace
https://www.awardspace.com/kb/where-to-find-the-affiliate-program-agreement/
Where to Find the Affiliate Program Agreement? - AwardSpace.com
May 2, 2025 - Find the Affiliate Program Agreement easily on our website. Here is where you can find the web hosting Affiliate Program Agreement.
affiliate program agreementfindawardspace
https://www.awardspace.com/kb/how-to-renew-your-hosting-services/
How to Renew Your Hosting Services - AwardSpace.com
Learn how to renew your hosting services by using the AwardSpace hosting dashboard - the process is very simple and takes only a few minutes.
hosting servicesrenewawardspace
https://www.awardspace.com/kb/register-domain-name/
How to Register a Domain Name | Awardspace.com
Feb 27, 2024 - This online tutorial provides brief instructions about how to register a domain name with Awardspace.
domain name awardspaceregister
https://www.awardspace.com/kb/how-to-install-joomla-extensions/
How to Install Joomla Extensions - AwardSpace.com
Jun 7, 2024 - Learn how to install Joomla extensions with a few easy-to-follow steps. AwardSpace's comprehensive guide helps you do so quickly and easily.
install joomlaextensionsawardspace
https://www.awardspace.com/kb/control-panel/orders-invoices/
Orders & Invoices - AwardSpace.com
orders invoicesawardspace
https://www.awardspace.com/kb/custom-php-versions/
How to set custom PHP versions for my domains - AwardSpace.com
Set custom PHP versions for all hostnames on Awardspace. Optimize your performance with tailored PHP settings on our platform.
set customphp versionsdomains awardspace
https://www.awardspace.com/use-cases/website-sandbox/
Website Sandbox - AwardSpace.com
Mar 5, 2026 - Test Website Features Safely. Use the hosting sandbox for secure testing with unlimited disk space and robust language and security support.
sandboxawardspace
https://www.awardspace.com/kb/upload-website-hosting-account/
How to Upload a Website to Your Hosting Account? - AwardSpace.com
Feb 28, 2024 - To get started, you will probably want to upload your site and test it on a free subdomain. Please go to your control panel Domain Manager menu and create a...
hosting accountuploadawardspace
https://www.awardspace.com/web-hosting/semi-dedicated-hosting/
Semi-Dedicated Hosting - AwardSpace.com
Mar 5, 2026 - Upgrade to Semi-Dedicated Hosting for large websites. Get unlimited resources, high performance (up to 50% dedicated CPU/RAM), and a free domain for life,...
semi dedicated hostingawardspace
https://www.awardspace.com/kb/tips-to-an-efficient-ticket-open/
Tips to an Efficient Ticket Open - AwardSpace.com
Jul 17, 2024 - Looking for help from the customer support? Here are some tips on how to write an efficient ticket so that you get faster solution.
tipsefficientticketopenawardspace
https://www.awardspace.com/kb/how-to-access-the-information-about-my-domains/
How to Access the Information About My Domains - AwardSpace.com
Oct 3, 2025 - Learn how to access information about your domains via the AwardSpace hosting panel and be updated about all changes regarding your domains.
domains awardspaceaccessinformation
https://www.awardspace.com/kb/whats-my-url/
I have signed up for your service, but what is my assigned website/URL? - AwardSpace.com
signedserviceurlawardspace
https://www.awardspace.com/signup/?id=6000&type=semi
Signup - AwardSpace.com
Oct 2, 2025 - You can sign up for Shared Hosting, FREE Web Hosting, or Semi-Dedicated Hosting and choose a domain, SSL Certificate, or VPS service as part of the process.
signup awardspace
https://www.awardspace.com/kb/how-to-install-a-mediawiki-skin/
How to Install a MediaWiki Skin - AwardSpace.com
Jan 6, 2025 - Read how to install a MediaWiki skin for your wiki project in a few simple-to-follow steps in our new AwardSpace tutorial.
installmediawikiskinawardspace
https://www.awardspace.com/wordpress-tutorials/wordpress-too-many-redirects/
How to Fix Too Many Redirects in WordPress | AwardSpace.com
Feb 28, 2024 - In this tutorial, we will be discussing one of the most common errors in WordPress - Too Many Redirects. In addition, we will provide you with a few possible...
many redirectswordpress awardspacefix
https://www.awardspace.com/signup/?id=704&type=vps
Signup - AwardSpace.com
Oct 2, 2025 - You can sign up for Shared Hosting, FREE Web Hosting, or Semi-Dedicated Hosting and choose a domain, SSL Certificate, or VPS service as part of the process.
signup awardspace
https://www.awardspace.com/free-joomla-hosting/
Free Joomla Hosting - AwardSpace.com
Mar 5, 2026 - Get Free Joomla Hosting, perfect for beginners, featuring a 1-click installer, 100% no ads, 99.9% network uptime, and professional email.
free joomlahosting awardspace
https://www.awardspace.com/kb/how-to-make-moodle-more-interactive/
How to Make Moodle More Interactive: Top 10 Strategies to Engage Learners - AwardSpace.com
Jan 28, 2025 - Discover how to make Moodle more interactive with powerful approaches that can help you engage learners and boost outcomes drastically.
top 10 strategiesengage learnersmakemoodleinteractive
https://www.awardspace.com/kb/how-to-purchase-domain-name/
How to Purchase a Domain Name? - AwardSpace.com
Feb 28, 2024 - To purchase a domain follow these steps: Log in to your Hosting Control Panel Open the Domain Manager Choose the Register a Domain option Enter your domain...
domain name awardspacepurchase
https://www.awardspace.com/wordpress-tutorials/gutenberg/
Gutenberg - WordPress Tutorials - AwardSpace.com
In this section of AwardSpace’s WordPress Tutorials, you will learn the everything about the Gutenberg Editor.
gutenberg wordpresstutorials awardspace
https://www.awardspace.com/frequently-asked-questions/
Frequently Asked Questions - AwardSpace.com
Oct 2, 2025 - Check AwardSpace's F.A.Q. for answers on General Account Questions (sign-up, closing account, troubleshooting), Domain Name Management, Website Management,...
frequently asked questionsawardspace
https://www.awardspace.com/kb/set-up-email-account-mozilla-thunderbird/
How to set up an email account on Mozilla Thunderbird? - AwardSpace.com
Aug 1, 2024 - Mozilla Thunderbird is one of the most famous and surely among the best email clients available. What is more, this magnificent piece of software is absolutely...
email accountmozilla thunderbirdsetawardspace
https://www.awardspace.com/wordpress-tutorials/how-to-add-facebook-comments/
How to Add Facebook Comments - AwardSpace.com
Feb 28, 2024 - To give your audience the opportunity to comment on your content is crucial to the relationship that you might create with the people that are following you....
add facebookcommentsawardspace
https://www.awardspace.com/wordpress-tutorials/wordpress-block-patterns/
Gutenberg Tutorial: Using Block Patterns in WordPress | AwardSpace.com
Oct 17, 2024 - The WordPress block patterns can greatly aid you in designing your website. So, learn how to use them to save time and focus on your content.
gutenberg tutorialusing blockwordpress awardspacepatterns
https://www.awardspace.com/kb/unzip-files-on-the-server/
How to Unzip Files Directly on the Server? - AwardSpace.com
unzip filesdirectlyserverawardspace
https://www.awardspace.com/kb/lost-account-password/
How to retrieve a lost account or password? - AwardSpace.com
Feb 27, 2024 - If you cannot remember your account password, you can use the “Lost Password” tool available on the “Login” page, next to the log-in form, at our website. The...
lost accountretrievepasswordawardspace
https://www.awardspace.com/kb/how-to-install-elgg/
How to Install Elgg - AwardSpace.com
Oct 24, 2024 - Read how to install Elgg quickly and easily. Start working on your new Elgg website right after installation with AwardSpace
installelggawardspace
https://www.awardspace.com/kb/how-to-log-in-to-joomla/
How to Log in to Joomla - AwardSpace.com
Oct 15, 2024 - Read how to log in to Joomla and how to open Joomla admin panel, so you can start working on your new website.
joomla awardspacelog
https://www.awardspace.com/about/guarantees/
Guarantees - AwardSpace.com
Oct 2, 2025 - AwardSpace's guarantees: 99.9% network uptime, 24/7 technical support, and a risk-free 30-Day Money-Back guarantee on all paid hosting plans.
guaranteesawardspace
https://www.awardspace.com/kb/how-to-change-your-name-in-moodle/
How to Change Your Name in Moodle - AwardSpace.com
Read how to change your name in Moodle in a few quick and easy-to-follow steps with the AwardSpace Moodle guide.
changenamemoodleawardspace
https://www.awardspace.com/kb/what-are-joomla-plugins/
What are Joomla Plugins - AwardSpace.com
Jun 7, 2024 - Read about what are Joomla plugins and how they help your website become more secure, engaging, and more functional.
joomla pluginsawardspace
https://www.awardspace.com/wordpress-tutorials/wordpress-update/
How to Update WordPress | WordPress Tutorials | AwardSpace
Sep 16, 2023 - Update WordPress to keep hackers at bay, and to make your website faster. Find out how to update WordPress both manually and automatically.
update wordpresstutorials awardspace
https://www.awardspace.com/kb/how-to-customize-the-dashboard-in-suitecrm/
How to Customize the Dashboard in SuiteCRM - AwardSpace.com
Read how to customize the dashboard in SuiteCRM and make it as convenient and effective for your project and your personal workflow.
suitecrm awardspacecustomizedashboard
https://www.awardspace.com/kb/message-count-quota-exceeded/
How to fix the "Message count quota exceeded" error? - AwardSpace.com
Feb 28, 2024 - In this article we will go through the error “Message count quota exceeded” that is caused by one of these restrictions.
quota exceededfixmessagecounterror
https://www.awardspace.com/kb/website-doesnt-work/
Website files are uploaded to my account, but the website doesn’t work - AwardSpace.com
Feb 27, 2024 - If you have uploaded your website files to your hosting account, but when you visit your website you see the old content or no content at all. A few things...
filesuploadedaccountworkawardspace
https://www.awardspace.com/kb/co-uk/
.CO.UK - AwardSpace.com
Feb 28, 2024 - The .co.uk is a country code second level UK domain extension, intended for websites located or doing business in the United Kingdom.
co ukawardspace
https://www.awardspace.com/kb/didnt-receive-welcome-email/
I Didn't Receive a Welcome Email. What should I do? - AwardSpace.com
Feb 28, 2024 - If you did not receive a welcome email inside your inbox within a few minutes please check your SPAM folder as well. Although rare, it is possible that the...
welcome emailreceiveawardspace
https://www.awardspace.com/kb/improve-scripting-skills/
How to improve my scripting skills? - AwardSpace.com
Feb 27, 2024 - One of the best websites on the internet for learning new or improving the scripting skills you already have would be W3Schools. Using the tutorials and...
improvescriptingskillsawardspace
https://www.awardspace.com/kb/configure-email-in-outlook/
How to Configure Your Email Account in Microsoft Outlook? | AwardSpace
Feb 28, 2024 - In this article we will guide you on how to configure your email account with AwardSpace inside Outlook.
email accountmicrosoft outlookconfigureawardspace
https://www.awardspace.com/use-cases/web-agency-website/
Web Agency Website - AwardSpace.com
Mar 5, 2026 - Launch Your Web Agency Site Hosting provides unlimited resources advanced security and an email client to manage and expand your online agency.
web agencyawardspace
https://www.awardspace.com/kb/ftp-login-incorrect/
FTP Login Incorrect | AwardSpace | Knowledge Base
Feb 28, 2024 - In this article we will review the error
awardspace knowledge baseftpincorrect
https://www.awardspace.com/kb/create-blog-post-concrete5/
How to Create a Blog Post with Concrete5 - AwardSpace.com
Jul 30, 2024 - Learn how to create and publish blog posts with Concrete5. From installation to customization, master the process to enhance website content.
blog postcreateconcrete5awardspace
https://www.awardspace.com/kb/establish-connection-smartftp/
How to Establish Connection with SmartFTP? - AwardSpace.com
Feb 28, 2024 - Use the following SmartFTP settings: Address: yourdomainname.com Login: Your FTP Username Password: Your FTP Password
establish connectionsmartftpawardspace
https://www.awardspace.com/kb/establish-connection-coreftp/
How to Establish Connection with CoreFTP? - AwardSpace.com
Feb 28, 2024 - Use the following CoreFTP settings: Site Name: Your Site Name Host/IP/URL: yourdomainname.com User name: Your FTP Username Password: Your FTP Password Port: 21...
establish connectionawardspace
https://www.awardspace.com/wordpress-tutorials/optimization/
WordPress Optimization WordPress Tutorials - AwardSpace.com
In the WordPress Optimization section, you will find easy-to-follow tutorials that will help you keep your WordPress site in top shape.
wordpress optimizationtutorials awardspace
https://www.awardspace.com/kb/disable-php-error-messages/
How to Disable PHP Error Messages - AwardSpace.com
Oct 17, 2024 - Learn how to disable PHP error messages easily with AwardSpace. Improve your website's security and user experience by hiding error messages.
php error messagesdisableawardspace
https://www.awardspace.com/kb/how-to-back-up-your-typo3-project/
How to Back Up your TYPO3 Project - AwardSpace.com
Read how to back up your TYPO3 project with a few easy steps and protect your website from any type of issues.
typo3 projectbackawardspace
https://www.awardspace.com/web-hosting/vps-cloud-hosting/
VPS Hosting - AwardSpace.com
vps hostingawardspace
https://www.awardspace.com/kb/what-is-a-domain-name-and-do-i-need-one/
What is a Domain Name and Do I Need One? - AwardSpace.com
Feb 28, 2024 - A domain name is the unique name of your website (like yahoo.com, microsoft.com, etc.) that differentiates it from the other sites on the Internet. The domain...
domain nameneed oneawardspace
https://www.awardspace.com/kb/file-manager-how-to-use/
File Manager - Features and Functions | AwardSpace.com
Jul 19, 2024 - This article provides brief instructions about how to use the AwardSpace File Manager utility, including information about some of its features.
file managerfunctions awardspacefeatures
https://www.awardspace.com/kb/what-is-a-mailbox/
What is a mailbox? - AwardSpace.com
Feb 28, 2024 - The physical folder where your incoming email messages are stored.
mailboxawardspace
https://www.awardspace.com/kb/what-fees-are-applied-when-my-commission-is-being-paid/
What fees are applied when my commission is being paid? - AwardSpace.com
Jul 17, 2024 - Learn more about the fees applied to the commission of your white-label web hosting store.
paid awardspacefeesappliedcommission
https://www.awardspace.com/wordpress-tutorials/how-to-prevent-wordpress-md5-hash-decrypt-exploits/
How to Prevent WordPress MD5 Hash Decrypt Exploits - AwardSpace.com
WordPress MD5 hash decrypt explained: how to secure passwords with updates, rehashing, salts/keys, and best practices.
prevent wordpressmd5 hashdecryptexploitsawardspace
https://www.awardspace.com/kb/change-wordpress-post-slug/
Change WordPress Post Slug - AwardSpace.com
Jul 8, 2024 - Find out how to change and optimize the slug of your WordPress posts and pages. How it reflects your website and search engine rankings.
change wordpresspost slugawardspace
https://www.awardspace.com/kb/ftp-connection-settings/
FTP Connection Settings | AwardSpace.com
Feb 27, 2024 - In this article you will learn how to locate your FTP connection settings, how to set up an FTP account in FileZilla, Cyberduck, CoffeeCup and Dreamweaver.
ftp connectionsettings awardspace
https://www.awardspace.com/kb/vps-manager/
VPS Manager - Basic Features | AwardSpace.com
Feb 27, 2024 - In this tutorial, we are going to review the AwardSpace VPS Manager and its features. We are also going to answer a few questions about administering a VPS...
basic featuresvpsmanagerawardspace
https://www.awardspace.com/kb/basic-features/
FTP Manager - Features & Functions | AwardSpace.com
Feb 27, 2024 - In this tutorial you will learn how to use the File Manager section in your AwardSpace Panel, including how to create an FTP account and add new FTP users.
manager featuresfunctions awardspaceftp
https://www.awardspace.com/kb/org/
.ORG - AwardSpace.com
Feb 28, 2024 - The .org is a top level domain and stands for organization. It is first intended for non-profit organizations but now can be used by anyone.
awardspace
https://www.awardspace.com/wordpress-tutorials/move-blocks-wordpress/
Gutenberg Tutorial: How to Move Blocks in WordPress | AwardSpace.com
Oct 17, 2024 - Learning how to move blocks in WordPress will allow you to rearrange the contents of your posts and pages.
gutenberg tutorialwordpress awardspacemoveblocks
https://www.awardspace.com/kb/how-to-install-a-drupal-theme/
How to Install a Drupal Theme - AwardSpace.com
Jun 7, 2024 - Read how to quickly install a Drupal theme of your choice and begin shaping your website the way you want it to look and feel.
theme awardspaceinstalldrupal
https://www.awardspace.com/drupal-hosting/
Drupal Hosting - AwardSpace.com
Mar 5, 2026 - Host your website with optimized Drupal Hosting. Benefit from speed optimization, extreme security, 99.9% uptime, and easy one-click installation.
drupal hostingawardspace
https://www.awardspace.com/kb/how-to-create-a-website-with-grav/
How to Create a Website with Grav - AwardSpace.com
Oct 16, 2024 - Read how to create a website with Grav CMS by following the easy-to-follow steps in the comprehensive AwardSpace guide.
grav awardspacecreate
https://www.awardspace.com/kb/site-does-not-open-fix/
My site does not open! How to fix it? - AwardSpace.com
Feb 27, 2024 - If you are unable to open your website through a browser and the response is “Server not found”, “No connection to host”, or something similar, there are a few...
siteopenfixawardspace
https://www.awardspace.com/kb/how-to-log-in-to-typo3/
How to Log in to TYPO3 - AwardSpace.com
Read how to quickly log in to TYPO3 with two simple methods and start working on your new website project in no time.
typo3 awardspacelog
https://www.awardspace.com/kb/how-to-install-mediawiki/
How to Install MediaWiki - AwardSpace.com
Jan 21, 2025 - Read how to install MediaWiki CMS quickly and easily and start building your online library of information and knowledge.
install mediawikiawardspace
https://www.awardspace.com/kb/change-php-version/
How Do I Update My PHP Version? | Knowledge Base | AwardSpace.com
Feb 27, 2024 - AwardSpace always provide you with access to the latest versions of PHP. Learn how to update your PHP version to the most recent one using this guide.
knowledge base awardspacephp versionupdate
https://www.awardspace.com/kb/webalizer/
Webalizer | AwardSpace.com
Feb 27, 2024 - In this article, you will learn how to enable Webalizer in your AwardSpace Control Panel and how to view and monitor your website usage reports.
awardspace
https://www.awardspace.com/kb/how-to-install-typo3/
How to Install TYPO3 - AwardSpace.com
Apr 1, 2025 - Read how to install TYPO3 CMS on any of the AwardSpace hosting plans quickly and easily and launch your successful project today.
install typo3awardspace
https://www.awardspace.com/kb/how-much-exactly-will-my-profit-be-from-a-single-hosting-account-that-i-sell/
How much exactly will my profit be from a single hosting account that I sell? - AwardSpace.com
Jul 16, 2024 - Find out how to much money you could make with our web hosting reseller program.
hosting accountmuchexactlyprofitsingle
https://www.awardspace.com/wordpress-tutorials/limit-wordpress-dashboard-access/
How to Limit WordPress Dashboard Access | WordPress Tutorials | AwardSpace
Feb 27, 2024 - At one time or another, it will be best for your website's security to limit Wordpress Dashboard Access. Find out how to achieve that the right way!
limit wordpressdashboard accesstutorials awardspace
https://www.awardspace.com/kb/how-should-i-use-the-affiliate-program/
How should I use the affiliate program? - AwardSpace.com
Oct 24, 2024 - Find out how to promote the affiliate program of your white-label web hosting store. Where to find affiliates and how it works.
affiliate programuseawardspace
https://www.awardspace.com/kb/create-a-page-in-wordpress/
Create a Page in WordPress - AwardSpace.com
Feb 27, 2024 - Learn how to create a new page in WordPress with AwardSpace's straightforward tutorial. Make your first steps with WordPress.
wordpress awardspacecreate