https://www.vegetariantimes.com/news/taco-bell-beyond-meat-steak/?scope=anon
Sep 21, 2022 - Taco Bell will launch a custom Beyond Meat carne asada steak next month. Here's everything you need to know about this plant-based collab
taco bellbeyond meatcollablaunchoctober
https://www.vegetariantimes.com/news/kim-kardashian-beyond-meat/?scope=anon
May 24, 2022 - Kim Kardashian has taken on a new gig. The celebrity is now 'chief taste consultant' for Beyond Meat and encouraging plant-based eating
kim kardashianbeyond meatpartnershipkicks
https://www.vox.com/future-perfect/2019/10/7/20880318/meatless-meat-mainstream-backlash-impossible-burger
Oct 7, 2019 - The growing pushback against Impossible and Beyond burgers in fast-food chains, explained
beyond meatbacklashimpossibleburgersgoing
https://www.vegetariantimes.com/news/kfc-beyond-meat/?scope=anon
Jan 5, 2022 - KFC will begin offering veggie Beyond Meat 'chicken' at locations across the U.S., but there's a big catch for plant-based eaters
beyond meatkfcchickenreallyvegetarians
https://www.vegetariantimes.com/news/beyond-meat-lawsuit/?scope=anon
Jul 11, 2022 - A class-action lawsuit claims Beyond Meat has mislead customers about protein content. The company calls the complaint "unfounded."
beyond meatlawsuitallegesmisleadingadvertising
https://www.greenqueen.com.hk/beyond-meat-dunkin-plant-based-trademark-lawsuit-vegadelphia/
Nov 26, 2025 - Plant-based giant Beyond Meat has been found to have infringed a trademark covering a slogan used in its ad with Dunkin', owing $39M in damages.
beyond meattrademarkbeefhitverdict
https://dgtl-festival.com/en/dgtl-amsterdam/partners/beyond-meat/
DGTL is a festival full of discovery, inspiration and surprise. At DGTL, we constantly strive to balance the leading names in art and electronic music.
beyond meat
https://www.jumbo.cl/hamburguesa-de-vegetales-beyond-85g-1964233/p
Hamburguesa Vegetal Beyond Meat 85 g
beyond meatvegetal
https://www.cfodive.com/news/beyond-meat-terminates-controller-identifying-material-weakness-accounting/808427/
Beyond Meat controller Yi Luo will leave the company on Dec. 23, approximately a month after it identified a material weakness relating to accounting practices...
beyond meatcfo divecontrollermaterialweakness