https://bmj.wistia.com/medias/xht9i12xbz
BMJ Best Practice: Managing comorbidities in the US
The BMJ Best Practice comorbidities manager supports healthcare professionals in treating patients with acute conditions and preexisting comorbidities. BMJ...
bmj best practicemanaging comorbiditiesus
https://bestpractice.bmj.com/topics/en-us/573
Parasomnias in adults - Symptoms, diagnosis and treatment | BMJ Best Practice US
Parasomnias are undesirable events occurring during sleep or during the transition into or out of sleep. They may occur during nonrapid eye movement or rapid...
diagnosis and treatmentbmj best practiceparasomniasadultssymptoms
https://bestpractice.bmj.com/topics/en-us/684
Erythema infectiosum - Symptoms, diagnosis and treatment | BMJ Best Practice US
Erythema infectiosum classically presents in childhood with a "slapped cheek" appearance followed by a reticular, erythematous eruption that is predominantly...
diagnosis and treatmentbmj best practiceerythema infectiosumsymptomsus
https://bestpractice.bmj.com/topics/en-us/682/investigations
Pertussis - Tests | BMJ Best Practice US
Pertussis (whooping cough) is an acute infectious disease caused by . Toxins and other factors produced by the bacteria are responsible for clinical...
bmj best practicepertussistests
https://bestpractice.bmj.com/topics/en-us/165/patient-leaflets
Pulmonary tuberculosis - Patient information | BMJ Best Practice US
Pulmonary tuberculosis (TB) is an infectious disease caused by . Key risk factors include exposure to infection, birth in an endemic country, and HIV...
bmj best practicepulmonary tuberculosispatient informationus
https://bestpractice.bmj.com/topics/en-us/517
Osteomalacia - Symptoms, diagnosis and treatment | BMJ Best Practice US
Osteomalacia is most commonly caused by vitamin D deficiency. Patients frequently complain of diffuse bony pain with a history of limited sunlight exposure....
diagnosis and treatmentbmj best practiceosteomalaciasymptomsus
https://bestpractice.bmj.com/topics/en-us/809
Schistosomiasis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Schistosomiasis is a neglected tropical disease that mainly affects poor and rural communities, especially agricultural and fishing populations. Patients most...
diagnosis and treatmentbmj best practiceschistosomiasissymptomsus
https://bestpractice.bmj.com/topics/en-us/687
Sudden infant death syndrome - Symptoms, diagnosis and treatment | BMJ Best Practice US
Sudden infant death syndrome is the leading cause of infant death beyond the neonatal period. Incidence roughly 1 in 2000 infants. Peak incidence between 1 and...
sudden infant death syndromediagnosis and treatmentbmj best practice
https://bestpractice.bmj.com/topics/en-us/1210/prognosis
Ebola disease - Prognosis | BMJ Best Practice US
Ebola disease is nonspecific in the early stages, which makes the differential diagnosis broad; therefore, clinical suspicion of the infection with prompt...
bmj best practiceebola diseaseprognosisus
https://bestpractice.bmj.com/topics/en-us/217/emergingtxs
Measles infection - Emerging treatments | BMJ Best Practice US
Measles is preventable by immunization but high levels of coverage are required to prevent outbreaks of disease from occurring. No specific treatment for...
bmj best practiceemerging treatmentsmeaslesinfectionus
https://bestpractice.bmj.com/topics/en-us/599
Retropharyngeal abscess - Symptoms, diagnosis and treatment | BMJ Best Practice US
Retropharyngeal abscess is a type of deep neck space infection, which can be a life-threatening infection if not detected early. Potential threat to airways...
diagnosis and treatmentbmj best practiceretropharyngeal abscesssymptomsus
https://bestpractice.bmj.com/topics/en-us/902/emergingtxs
Poliovirus infection - Emerging treatments | BMJ Best Practice US
Poliovirus infection is usually asymptomatic. When symptomatic, the most common presentation is a minor gastrointestinal illness. Acute flaccid paralysis...
bmj best practiceemerging treatmentspoliovirusinfection
https://bestpractice.bmj.com/topics/en-us/158
Evaluation of polyneuropathy - Differential diagnosis of symptoms | BMJ Best Practice US
Polyneuropathy is a generalized disease of the peripheral nerves due to damage to the axon and/or myelin sheath. Estimates on the prevalence in the general...
bmj best practicedifferential diagnosisevaluationpolyneuropathysymptoms
https://bestpractice.bmj.com/topics/en-us/1038
Sialadenitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Sialadenitis is the inflammation and enlargement of one or several major salivary glands. It most commonly affects parotid and submandibular glands. Bacterial...
diagnosis and treatmentbmj best practicesialadenitissymptomsus
https://bestpractice.bmj.com/topics/en-us/845
Evaluation of hoarseness and dysphonia - Differential diagnosis of symptoms | BMJ Best Practice US
Dysphonia, also known as hoarseness, is a general term used to describe a variety of changes in voice quality. Individuals with hoarseness or voice changes...
bmj best practicedifferential diagnosis
https://bestpractice.bmj.com/info/us/customerstory/integrating-bmj-best-practice-into-our-ehr-system/
Integrating BMJ Best Practice into our EHR system | BMJ Best Practice
bmj best practiceintegratingehrsystem
https://bestpractice.bmj.com/topics/en-us/3000325
Tardive dyskinesia - Symptoms, diagnosis and treatment | BMJ Best Practice US
Tardive dyskinesia (TD) is a neurologic disorder that typically presents with repetitive, involuntary movements, emerging in the context of long-term use of...
diagnosis and treatmentbmj best practicetardive dyskinesiasymptomsus
https://bestpractice.bmj.com/topics/en-us/481
Polycystic kidney disease - Symptoms, diagnosis and treatment | BMJ Best Practice US
Polycystic kidney disease (PKD) is an inherited renal cystic disease, of which autosomal-dominant polycystic kidney disease is the more common form....
polycystic kidney diseasediagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/82
Gastroesophageal reflux disease - Symptoms, diagnosis and treatment | BMJ Best Practice US
Gastroesophageal reflux disease (GERD) is a clinical diagnosis. The classic symptoms are heartburn and regurgitation. A therapeutic trial of a proton-pump...
diagnosis and treatmentbmj best practicegastroesophageal refluxdisease symptoms
https://bestpractice.bmj.com/topics/en-us/162/diagnosis-approach
Diabetic ketoacidosis - Diagnosis recommendations | BMJ Best Practice US
Diabetic ketoacidosis (DKA) is characterized by a biochemical triad of hyperglycemia, ketonemia, and acidemia, with rapid symptom onset.Common symptoms and...
bmj best practicediabetic ketoacidosisdiagnosisrecommendationsus
https://bestpractice.bmj.com/topics/en-us/443
Pinworm infection - Symptoms, diagnosis and treatment | BMJ Best Practice US
Pinworm infection is the most common helminthic infection in the US. Although most infected individuals are asymptomatic, perianal itching is the most common...
diagnosis and treatmentbmj best practicepinworminfectionsymptoms
https://bestpractice.bmj.com/topics/en-us/810
Botulism - Symptoms, diagnosis and treatment | BMJ Best Practice US
Botulism is a clinical syndrome characterized by cranial nerve palsies, oculobulbar weakness, and descending, symmetrical flaccid paralysis in the absence of...
diagnosis and treatmentbmj best practicebotulismsymptomsus
https://bestpractice.bmj.com/topics/en-us/916
Tularemia - Symptoms, diagnosis and treatment | BMJ Best Practice US
Tularemia is spread by ticks, biting flies, direct contact with infected animals or animal skin, or inhalation of aerosols when doing yard work where infected...
diagnosis and treatmentbmj best practicetularemiasymptomsus
https://bestpractice.bmj.com/topics/en-us/172
Acute prostatitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Acute prostatitis is usually caused by organisms entering the prostate from urinary tract infections. Commonly caused by bacteria. Symptoms include dysuria,...
diagnosis and treatmentbmj best practiceacuteprostatitissymptoms
https://bestpractice.bmj.com/topics/en-us/3000168/diagnosis-approach
Coronavirus disease 2019 (COVID-19) - Diagnosis recommendations | BMJ Best Practice US
Coronavirus disease 2019 (COVID-19) is a potentially severe acute respiratory infection.Respiratory transmission is the dominant mode of transmission, with...
bmj best practicecoronavirus diseasecovid
https://bestpractice.bmj.com/topics/en-us/9999
African trypanosomiasis - Symptoms, diagnosis and treatment | BMJ Best Practice US
African trypanosomiasis is fatal without treatment. The recommended antitrypanosomal drugs are only available from the Centers for Disease Control and...
diagnosis and treatmentbmj best practiceafricantrypanosomiasissymptoms
https://bestpractice.bmj.com/topics/en-us/165/epidemiology
Pulmonary tuberculosis - Epidemiology | BMJ Best Practice US
Pulmonary tuberculosis (TB) is an infectious disease caused by . Key risk factors include exposure to infection, birth in an endemic country, and HIV...
bmj best practicepulmonary tuberculosisepidemiologyus
https://bestpractice.bmj.com/topics/en-us/69/references
Evaluation of chronic cough - References | BMJ Best Practice US
Cough is one of the most common presenting symptom in primary practice. Subacute cough is defined as cough persisting for 3-8 weeks, and chronic cough as that...
bmj best practicechronic coughevaluationreferencesus
https://bestpractice.bmj.com/topics/en-us/902/prevention
Poliovirus infection - Prevention | BMJ Best Practice US
Poliovirus infection is usually asymptomatic. When symptomatic, the most common presentation is a minor gastrointestinal illness. Acute flaccid paralysis...
bmj best practiceinfection preventionpoliovirus
https://bestpractice.bmj.com/topics/en-us/452/treatment-algorithm
Epiglottitis - Treatment algorithm | BMJ Best Practice US
Epiglottitis is an infection of the supraglottis that may cause airway compromise due to inflammation and swelling. It is an airway emergency, especially in...
bmj best practiceepiglottitistreatmentalgorithmus
https://bestpractice.bmj.com/topics/en-us/633
Vitamin B1 deficiency - Symptoms, diagnosis and treatment | BMJ Best Practice US
Vitamin B1 (thiamine) deficiency is the underlying cause of several clinical syndromes, including Wernicke encephalopathy, wet beriberi, and dry beriberi....
diagnosis and treatmentbmj best practicevitamindeficiencysymptoms
https://bestpractice.bmj.com/topics/en-us/946
Graft versus host disease - Symptoms, diagnosis and treatment | BMJ Best Practice US
Graft versus host disease (GVHD) is a major cause of morbidity and mortality following allogeneic hematopoietic cell transplantation (HCT). Occurs when donor T...
diagnosis and treatmentbmj best practicedisease symptoms
https://bestpractice.bmj.com/topics/en-us/83/prognosis
Acute kidney injury - Prognosis | BMJ Best Practice US
Acute kidney injury (AKI) is commonly associated with sepsis, cardiovascular collapse, congestive heart failure, major surgery, nephrotoxins (such as...
acute kidney injurybmj best practiceprognosisus
https://bestpractice.bmj.com/topics/en-us/1086
Inpatient glycemic management - Symptoms, diagnosis and treatment | BMJ Best Practice US
Inpatient hyperglycemia is not merely a transient response to illness or stress, but a condition that requires active management. In both critical and...
diagnosis and treatmentbmj best practiceinpatientglycemicmanagement
https://bmjgroup.com/category/bmj-best-practice/
BMJ Best Practice - BMJ Group
bmj best practicegroup
https://bestpractice.bmj.com/topics/en-us/1023
Evaluation of neutrophilia - Differential diagnosis of symptoms | BMJ Best Practice US
Neutrophilia may occur with or without an elevated white blood cell (WBC) count (leukocytosis). Neutrophilia without leukocytosis is defined as an elevated...
bmj best practicedifferential diagnosisevaluationsymptomsus
https://edshare.gla.ac.uk/324/
Accessing the Knowledge Network and BMJ Best Practice - EdShare at Glasgow
the knowledge networkbmj best practiceaccessing
https://bestpractice.bmj.com/topics/en-us/940
Minimal change disease - Symptoms, diagnosis and treatment | BMJ Best Practice US
Minimal change disease (MCD) is the most common form of idiopathic nephrotic syndrome (NS) in children (70% to 90% of cases) and is characterized by minimal...
minimal change diseasediagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/28
Bronchiolitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Bronchiolitis is the leading cause of hospital admission in infants under 1 year of age. Respiratory syncytial virus (RSV) is the most common cause. Most cases...
diagnosis and treatmentbmj best practicebronchiolitissymptomsus
https://bestpractice.bmj.com/topics/en-us/405
Wernicke encephalopathy - Symptoms, diagnosis and treatment | BMJ Best Practice US
Wernicke encephalopathy is an acute neurologic emergency caused by thiamine (vitamin B1) deficiency. Underdiagnosed in clinical practice. Most commonly...
diagnosis and treatmentbmj best practiceencephalopathysymptomsus
https://bestpractice.bmj.com/topics/en-us/539/prevention
Bacterial meningitis - Prevention | BMJ Best Practice US
Bacterial meningitis represents a life-threatening inflammation of the meninges. and are the predominant causative pathogens in both adults and children. It...
bmj best practicebacterial meningitispreventionus
https://bestpractice.bmj.com/topics/en-us/965
Overview of vertigo - Summary of relevant conditions | BMJ Best Practice US
Vertigo is the sensation that the environment is spinning around relative to oneself (objective vertigo) or vice versa (subjective vertigo). The term is...
bmj best practiceoverview ofvertigosummaryrelevant
https://bestpractice.bmj.com/topics/en-us/785
Depression in children - Symptoms, diagnosis and treatment | BMJ Best Practice US
Depression in children is characterized by sad or irritable mood, anhedonia, decreased capacity to have fun, decreased self-esteem, sleep disturbance, social...
depression in childrendiagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/162/calculators
Diabetic ketoacidosis - Calculators | BMJ Best Practice US
Diabetic ketoacidosis (DKA) is characterized by a biochemical triad of hyperglycemia, ketonemia, and acidemia, with rapid symptom onset.Common symptoms and...
bmj best practicediabetic ketoacidosiscalculatorsus
https://bestpractice.bmj.com/topics/en-us/821
Necrotizing fasciitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Necrotizing fasciitis is a life-threatening subcutaneous soft-tissue infection that requires a high index of suspicion for diagnosis.Infection may be...
diagnosis and treatmentbmj best practicenecrotizing fasciitissymptomsus
https://bestpractice.bmj.com/topics/en-us/87
Atopic dermatitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Atopic dermatitis (eczema) commonly presents with dry, itchy skin. Typically there is erythema, scaling, vesicles, or lichenification in skin flexures....
diagnosis and treatmentbmj best practiceatopic dermatitissymptomsus
https://bestpractice.bmj.com/topics/en-us/914
Listeriosis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Listeriosis is a gram-positive bacterial infection that primarily affects neonates, pregnant women, adults ages over 45-50 years, and immunocompromised people....
diagnosis and treatmentbmj best practicelisteriosissymptomsus
https://bestpractice.bmj.com/topics/en-us/10
Migraine headache in adults - Symptoms, diagnosis and treatment | BMJ Best Practice US
Migraine is a chronic, episodic, neurologic disorder that can have a severe effect on quality of life, but it is often under-diagnosed and under-treated....
diagnosis and treatmentbmj best practicemigraine headache
https://bestpractice.bmj.com/topics/en-us/3000168/references
Coronavirus disease 2019 (COVID-19) - References | BMJ Best Practice US
Coronavirus disease 2019 (COVID-19) is a potentially severe acute respiratory infection.Respiratory transmission is the dominant mode of transmission, with...
bmj best practicecoronavirus diseasecovidreferences
https://bestpractice.bmj.com/topics/en-us/3000344
Medication overuse headache - Symptoms, diagnosis and treatment | BMJ Best Practice US
Medication overuse headache (MOH) is a chronic secondary headache condition attributable to overuse of acute medication(s) by an individual with a preexisting...
medication overuse headachediagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/1174
Shigella infection - Symptoms, diagnosis and treatment | BMJ Best Practice US
Shigella infection is easily spread by fecal-oral contact or by contaminated water or food. It usually presents as a mild, self-limited diarrheal illness. is...
diagnosis and treatmentbmj best practiceshigellainfectionsymptoms
https://bestpractice.bmj.com/topics/en-us/759
Congenital torticollis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Congenital torticollis is a neck deformity that involves shortening of the sternocleidomastoid (SCM) muscle resulting in limited neck rotation and lateral...
diagnosis and treatmentbmj best practicecongenital torticollissymptomsus
https://bestpractice.bmj.com/topics/en-us/3000328
Hepatitis E - Symptoms, diagnosis and treatment | BMJ Best Practice US
Hepatitis E virus (HEV) infection affects millions of people globally. It is most prevalent in Africa and Asia, and is increasing in parts of Europe but...
diagnosis and treatmentbmj best practicehepatitissymptomsus
https://bestpractice.bmj.com/topics/en-us/675
Cleft lip and palate - Symptoms, diagnosis and treatment | BMJ Best Practice US
Cleft lip with or without cleft palate is approximately twice as common as isolated cleft palate. The majority of cleft lip deformities are associated with a...
cleft lip and palatebmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/679
Intussusception - Symptoms, diagnosis and treatment | BMJ Best Practice US
Intussusception most commonly occurs in infants between the ages of 3 and 12 months, with a peak between ages 5 and 9 months. Presentation often includes...
diagnosis and treatmentbmj best practiceintussusceptionsymptoms
https://bestpractice.bmj.com/topics/en-us/162/differentials
Diabetic ketoacidosis - Differentials | BMJ Best Practice US
Diabetic ketoacidosis (DKA) is characterized by a biochemical triad of hyperglycemia, ketonemia, and acidemia, with rapid symptom onset.Common symptoms and...
bmj best practicediabetic ketoacidosisdifferentialsus
https://bestpractice.bmj.com/topics/en-us/960
Evaluation of vision loss - Differential diagnosis of symptoms | BMJ Best Practice US
Vision loss may occur from an abnormality at any point in the visual pathway from the tear film to the occipital cortex. The most important factor to determine...
bmj best practicevision lossdifferential diagnosisevaluation
https://bestpractice.bmj.com/topics/en-us/630
Varicose veins - Symptoms, diagnosis and treatment | BMJ Best Practice US
Varicose veins are very common, affecting up to 40% of the population, but not all are symptomatic. Clinical presentation includes lower extremity pain,...
diagnosis and treatmentbmj best practicevaricose veinssymptomsus
https://bestpractice.bmj.com/topics/en-us/917
Cryptococcosis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Cryptococcosis can be fatal if unrecognized and untreated, regardless of immune status. Microbiology, cryptococcal polysaccharide antigen (CrAg), or...
diagnosis and treatmentbmj best practicecryptococcosissymptomsus
https://bestpractice.bmj.com/topics/en-us/106
Oral candidiasis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Oral candidiasis is an oral infection resulting from yeasts of the genus , mostly . The pseudomembranous form is commonly known as "thrush". Superficial local...
diagnosis and treatmentbmj best practiceoral candidiasissymptomsus
https://bestpractice.bmj.com/topics/en-us/1149
Cryptosporidiosis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Cryptosporidiosis is a disease caused by the Apicomplexan protozoan parasite . Laboratory diagnosis is required, usually by detection of oocysts, antigens, or...
diagnosis and treatmentbmj best practicecryptosporidiosissymptomsus
https://bestpractice.bmj.com/topics/en-us/1210/complications
Ebola disease - Complications | BMJ Best Practice US
Ebola disease is nonspecific in the early stages, which makes the differential diagnosis broad; therefore, clinical suspicion of the infection with prompt...
bmj best practiceebola diseasecomplicationsus
https://bestpractice.bmj.com/topics/en-us/143
Evaluation of acute diarrhea - Differential diagnosis of symptoms | BMJ Best Practice US
Diarrhea can be defined as the passage of: Based on duration, diarrhea is classified as:
bmj best practiceacute diarrheadifferential diagnosisevaluation
https://bestpractice.bmj.com/topics/en-us/452/aetiology
Epiglottitis - Etiology | BMJ Best Practice US
Epiglottitis is an infection of the supraglottis that may cause airway compromise due to inflammation and swelling. It is an airway emergency, especially in...
bmj best practiceepiglottitisetiologyus
https://bestpractice.bmj.com/topics/en-us/698
Aortic coarctation - Symptoms, diagnosis and treatment | BMJ Best Practice US
diagnosis and treatmentbmj best practiceaortic coarctationsymptomsus
https://bestpractice.bmj.com/topics/en-us/539/epidemiology
Bacterial meningitis - Epidemiology | BMJ Best Practice US
Bacterial meningitis represents a life-threatening inflammation of the meninges. and are the predominant causative pathogens in both adults and children. It...
bmj best practicebacterial meningitisepidemiologyus
https://bestpractice.bmj.com/topics/en-us/1093
Hypogonadism in men - Symptoms, diagnosis and treatment | BMJ Best Practice US
Hypogonadism in men may present with reproductive/sexual clinical features (e.g., incomplete pubertal development, subfertility, gynecomastia), as well as...
diagnosis and treatmentbmj best practicehypogonadismsymptoms
https://bestpractice.bmj.com/topics/en-us/623
Evaluation of clubbing - Differential diagnosis of symptoms | BMJ Best Practice US
bmj best practicedifferential diagnosisevaluationclubbingsymptoms
https://bestpractice.bmj.com/topics/en-us/83/management-approach
Acute kidney injury - Management recommendations | BMJ Best Practice US
Acute kidney injury (AKI) is commonly associated with sepsis, cardiovascular collapse, congestive heart failure, major surgery, nephrotoxins (such as...
acute kidney injurybmj best practicemanagementrecommendationsus
https://bestpractice.bmj.com/topics/en-us/710
Evaluation of memory deficit - Differential diagnosis of symptoms | BMJ Best Practice US
Memory is the tie that binds together thoughts, impressions, and experiences. Memory function is dependent on several mental or cognitive abilities using...
bmj best practicedifferential diagnosisevaluationmemorydeficit
https://bestpractice.bmj.com/topics/en-us/867
Phenylketonuria - Symptoms, diagnosis and treatment | BMJ Best Practice US
Phenylketonuria (PKU) is a rare inborn error of metabolism associated with elevated blood phenylalanine. Clinical features in untreated patients include...
diagnosis and treatmentbmj best practicephenylketonuriasymptomsus
https://bestpractice.bmj.com/topics/en-us/8/aetiology
Acute exacerbation of chronic obstructive pulmonary disease - Etiology | BMJ Best Practice US
An acute exacerbation of chronic obstructive pulmonary disease (COPD) typically presents with an increased level of dyspnea, worsening of chronic cough, and/or...
bmj best practicepulmonary disease
https://bestpractice.bmj.com/topics/en-us/1210/investigations
Ebola disease - Tests | BMJ Best Practice US
Ebola disease is nonspecific in the early stages, which makes the differential diagnosis broad; therefore, clinical suspicion of the infection with prompt...
bmj best practiceebola diseasetestsus
https://bestpractice.bmj.com/topics/en-us/586
Rotator cuff injury - Symptoms, diagnosis and treatment | BMJ Best Practice US
Rotator cuff injury is a common cause of shoulder pain, especially in older and active people. Tears can be symptomatic or asymptomatic. The cause of a rotator...
rotator cuff injurydiagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/312
Non-Hodgkin lymphoma - Symptoms, diagnosis and treatment | BMJ Best Practice US
Non-Hodgkin lymphomas (NHLs) are a heterogeneous group of lymphoid malignancies. Clinical history and presenting signs/symptoms depend on the type and location...
non hodgkin lymphomadiagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/3000168/treatment-algorithm
Coronavirus disease 2019 (COVID-19) - Treatment algorithm | BMJ Best Practice US
Coronavirus disease 2019 (COVID-19) is a potentially severe acute respiratory infection.Respiratory transmission is the dominant mode of transmission, with...
bmj best practicecoronavirus diseasecovid
https://bestpractice.bmj.com/topics/en-us/1085
Obesity in children - Symptoms, diagnosis and treatment | BMJ Best Practice US
Obesity in children has increased in recent decades. Causes are multifactorial including biologic, genetic disposition, behavioral and environmental...
diagnosis and treatmentbmj best practicein childrenobesitysymptoms
https://bestpractice.bmj.com/topics/en-us/502
Compartment syndrome of extremities - Symptoms, diagnosis and treatment | BMJ Best Practice US
Compartment syndrome of the extremities is a surgical emergency that results from increased interstitial pressure in closed osteofascial compartments. Can be...
diagnosis and treatmentbmj best practicecompartment syndrome
https://bestpractice.bmj.com/topics/en-us/480
IgA nephropathy - Symptoms, diagnosis and treatment | BMJ Best Practice US
About 50% of patients with IgA nephropathy present with recurrent episodes of visible hematuria after an upper respiratory tract infection or gastroenteritis;...
diagnosis and treatmentbmj best practiceiga nephropathysymptomsus
https://bestpractice.bmj.com/topics/en-us/682/management-approach
Pertussis - Management Approach | BMJ Best Practice US
Pertussis (whooping cough) is an acute infectious disease caused by . Toxins and other factors produced by the bacteria are responsible for clinical...
bmj best practicemanagement approachpertussis
https://bestpractice.bmj.com/topics/en-us/14
Acute rhinosinusitis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Majority of cases of acute rhinosinusitis in adults and children are of viral etiology. Duration of symptoms more than 10 days often indicates bacterial cause....
diagnosis and treatmentbmj best practiceacuterhinosinusitissymptoms
https://bestpractice.bmj.com/topics/en-us/1119
Evaluation of oral ulceration - Differential diagnosis of symptoms | BMJ Best Practice US
Oral ulcerations of the mucosal surfaces are common. Most are self-resolving and transient (e.g., after a simple cheek bite). They are usually painful,...
bmj best practicedifferential diagnosisevaluationoral
https://bestpractice.bmj.com/topics/en-us/614
Miliaria - Symptoms, diagnosis and treatment | BMJ Best Practice US
Miliaria, in all forms, is due to the occlusion or disruption of the eccrine sweat ducts at various levels of the skin due to excessive sweating in hot or...
diagnosis and treatmentbmj best practicesymptomsus
https://bmjgroup.com/bmj-best-practice-selected-by-google-deepmind-for-clinical-ai-evaluation/
BMJ Best Practice selected by Google DeepMind for clinical AI evaluation -
Jun 24, 2026 - BMJ Best Practice was selected as one of only two core clinical guideline resources used in the study, alongside NICE guidance.
bmj best practiceselected bygoogle deepmindclinical ai
https://bestpractice.bmj.com/topics/en-us/738
Diphtheria - Symptoms, diagnosis and treatment | BMJ Best Practice US
Diphtheria is a vaccine-preventable, toxin-mediated bacterial disease caused by . Outbreaks occur across the globe in populations with low vaccine coverage....
diagnosis and treatmentbmj best practicediphtheriasymptomsus
https://bestpractice.bmj.com/topics/en-us/255
Testicular cancer - Symptoms, diagnosis and treatment | BMJ Best Practice US
Testicular cancer most commonly presents as a hard, painless nodule on one testis noticed by the patient or at a regular clinic exam. Elevated serum tumor...
diagnosis and treatmentbmj best practicetesticular cancersymptomsus
https://bestpractice.bmj.com/topics/en-us/3000310
Mast cell activation syndrome - Symptoms, diagnosis and treatment | BMJ Best Practice US
Mast cell activation syndrome (MCAS) is a rare condition that is characterized by recurrent sudden-onset episodes of severe systemic symptoms associated with...
mast cell activation syndromediagnosis and treatmentbmj best practice
https://bestpractice.bmj.com/topics/en-us/997
Frostbite - Symptoms, diagnosis and treatment | BMJ Best Practice US
Frostbite severity is determined by the depth of the freezing and subsequent injury. Grading scales are sometimes used to guide therapy. Diagnosis is clinical,...
diagnosis and treatmentbmj best practicefrostbitesymptomsus
https://bestpractice.bmj.com/topics/en-us/829
Long QT syndrome - Symptoms, diagnosis and treatment | BMJ Best Practice US
Long QT syndrome (LQTS) is characterized by a prolonged QT interval on ECG, which may be congenital or acquired. In congenital LQTS, genetic mutations affect...
long qt syndromediagnosis and treatmentbmj best practicesymptoms
https://bestpractice.bmj.com/topics/en-us/378
Pressure ulcer - Symptoms, diagnosis and treatment | BMJ Best Practice US
Pressure ulcers are a common problem in hospital inpatients and people who live in care facilities. Older people, and all patients with limited mobility or...
diagnosis and treatmentbmj best practicepressure ulcersymptomsus
https://bestpractice.bmj.com/topics/en-us/700
Down syndrome - Symptoms, diagnosis and treatment | BMJ Best Practice US
Down syndrome is the most common genetic cause of cognitive or intellectual disability, with an incidence of 1 in 800-1000 births worldwide. Characteristic...
diagnosis and treatmentbmj best practicedown syndromesymptomsus
https://bestpractice.bmj.com/topics/en-us/1052
Lambert-Eaton myasthenic syndrome - Symptoms, diagnosis and treatment | BMJ Best Practice US
Lambert-Eaton myasthenic syndrome (LEMS) is a rare autoimmune disorder of the neuromuscular junction. Symptoms include insidious and gradual onset of fatigue,...
diagnosis and treatmentbmj best practice
https://bestpractice.bmj.com/topics/en-us/866
Multiple endocrine neoplasia syndromes - Symptoms, diagnosis and treatment | BMJ Best Practice US
Multiple endocrine neoplasia syndromes are hereditary tumor syndromes with distinct patterns of organ involvement. Mutations in the MEN1 gene typically cause...
multiple endocrine neoplasiadiagnosis and treatmentbmj best practice
https://bestpractice.bmj.com/topics/en-us/352
Sexual dysfunction in women - Symptoms, diagnosis and treatment | BMJ Best Practice US
Sexual dysfunction in women of all sexual orientations correlates most strongly with poor mental health and with negative feelings for the partner(s), rather...
sexual dysfunction in womendiagnosis and treatmentbmj best practice
https://bestpractice.bmj.com/topics/en-us/682/evidence
Pertussis - Evidence | BMJ Best Practice US
Pertussis (whooping cough) is an acute infectious disease caused by . Toxins and other factors produced by the bacteria are responsible for clinical...
bmj best practicepertussisevidence
https://bestpractice.bmj.com/topics/en-us/415
Subarachnoid hemorrhage - Symptoms, diagnosis and treatment | BMJ Best Practice US
Subarachnoid hemorrhage (SAH) presents as a sudden severe headache, often described as "the worst headache of life," with nausea, vomiting, and...
diagnosis and treatmentbmj best practicesubarachnoid hemorrhagesymptomsus
https://bestpractice.bmj.com/topics/en-us/616
Actinic keratosis - Symptoms, diagnosis and treatment | BMJ Best Practice US
Actinic keratosis lesions are chronic keratotic lesions on adult skin that has been chronically exposed to ultraviolet rays. Has the potential to progress into...
diagnosis and treatmentbmj best practiceactinic keratosissymptomsus
https://bestpractice.bmj.com/topics/en-us/94
Iron deficiency anemia - Symptoms, diagnosis and treatment | BMJ Best Practice US
Iron deficiency anemia (IDA) is the most common form of anemia. Causes include decreased iron intake, increased iron loss, and increased iron requirements....
iron deficiency anemiadiagnosis and treatmentbmj best practicesymptoms
https://casereports-corporate.bmj.com/bmj-best-practice-patient-leaflets-awarded-the-information-standard/
BMJ Best Practice patient leaflets awarded The Information Standard | Case Reports Corporate
BMJ Best Practice patient leaflets have been awarded The Information Standard for another year. BMJ, September 2016 The Information Standard is a way of...
bmj best practicepatient leaflets
https://bestpractice.bmj.com/topics/en-us/112
Overview of seizure disorder - Summary of relevant conditions | BMJ Best Practice US
A seizure is defined as "a transient occurrence of signs and/or symptoms due to abnormal excessive or synchronous neuronal activity in the brain." Epilepsy is...
bmj best practiceoverview ofseizure disordersummary