https://www.internetlawyer-blog.com/
Internet Lawyer Blog — Published by Law Offices of Salar Atrizadeh
Internet Lawyer Blog — Published by Law Offices of Salar Atrizadeh
internet lawyer blogpublished by
https://peelregion.ca/by-laws/by-law-number-23-2019
BY-LAW NUMBER 23-2019 - peelregion.ca
by lawnumberca
https://www.duiqueen.com/blog/2017/june/
Blogs from June 2017 by Law Offices of Virginia L. Landry, Inc.
Our Laguna Hills Attorney blog contains news and info from June of 2017 about DUI in Aliso Viejo.
law offices of
https://www.ttc.ca/by-law-no-1
TTC By-law No. 1
Regulates the use of the TTC local passenger transportation system
by lawttc
https://picklelake.ca/by-laws/2022-01/
By-Law #2022-01
Feb 8, 2026 - Being a confirmation by-law regarding a meeting of council held on the 11th day of January, 2022
by law
https://iowadot.gov/registration-plates/other-vehicle-services/abandoned-vehicles/law-enforcement-operations
Abandoned Vehicle Operations by Law Enforcement | Department of Transportation
The police authority's responsibility for abandoned vehicles in Iowa.
abandoned vehicleby lawdepartment ofoperationsenforcement
https://canadabusinesslawyers.com/step-by-step-law/
Step By Step Law | Family Law Langford British Columbia
May 2, 2025 - Step By Step Law in Langford, BC offers customized family law services, including unbundled legal services, legal coaching, and mediation. Family Law,...
by lawstepfamilylangfordbritish
https://lawtigers.com/donnie-smith-swap-meet-sponsored-by-law-tigers-in-twin-cities/
Donnie Smith Swap Meet Sponsored by Law Tigers in Twin Cities - Law Tigers
swap meetsponsored bydonniesmith
https://iqaluit.ca/content/2011-mill-rate-service-law-amendment-law-723-eng
2011 Mill Rate Service By Law Amendment By Law #723 ENG | City of Iqaluit
mill rateby law
https://iqaluit.ca/content/civic-holiday-toonik-tyme-law-735
Civic Holiday (Toonik Tyme) By-law #735 | City of Iqaluit
civic holidayby lawcity oftooniktyme
https://incrediblelawyer.com/by-law-how-many-rooms-can-a-housekeeper-clean-per-day/
Housekeeper's Daily Limit: By Law, 15 Rooms
Jul 10, 2024 - Labor laws play a vital role in safeguarding the rights and welfare of workers, including housekeepers. Many nations have implemented specific..
by lawhousekeeperdailylimitrooms
https://www.exceleratelabs.com/law-software/best-software-for-family-lawyers
Best Software for Family Lawyers (Rated by Law Firms)
Family law software is revolutionizing the legal industry. Family law firms of any size can benefit as long as they invest in the right software for family...
best softwarefor familyby lawlawyersrated
https://www.guitartabs.cc/tabs/d/down_by_law/no_equalizer_btab_ver_2.html
Down By Law - No Equalizer Chords & Tabs
No Equalizer by Down By Law Bass Tab Different Versions Chords, Tab, Tabs. Key Variations. Play Advices. Chords Diagrams. Guitar Tabs Universe
down by lawequalizerchordstabs
https://openbylaws.org.za/akn/za-jhb/act/by-law/2017/365/eng@2017-04-26
Treated Effluent By-law, 2017 – Open By-laws
by lawtreatedeffluentopenlaws
https://havengear.com/blog/what-type-of-riot-gear-is-used-by-law-enforcement/
What Type of Riot Gear Is Used By Law Enforcement? - Haven Gear
Jul 28, 2020 - Riot suits and gear for law enforcement play a critical role in keeping the public safe from disruptive individuals on a day-to-day basis.
riot gearused bylaw enforcementtype
https://www.digitaljournal.com/world/racism-in-cuba-banned-by-law-alive-on-the-streets/article/575002
Racism in Cuba: banned by law, alive on the streets - Digital Journal
Mar 26, 2021 - Six decades on from Cuba's proclamation of equality and despite three top government officials being black, the Caribbean island nation has made little
on the streetsby law
https://catalogue-moncton.hub.arcgis.com/datasets/by-law-shediac-harrisville-1519-3-final
By-law - Shediac-Harrisville - 1519.3. Final
City of Moncton - Open Data
by lawshediacharrisvillefinal
https://www.lawattractionplus.com/2024/11/attract-someone-law-attraction.html
Can We Attract Someone by Law of Attraction? | Law of Attraction Plus: The Secret revealed!
Many people use it to attract wealth, success, and happiness, but can it also be used to attract a specific person into your life?
law of attraction
https://www.southwestmiddlesex.ca/laws/collection-disposal-solid-waste-recyclable-materialswaste-management-law
Collection & Disposal of Solid Waste & Recyclable Materials/Waste Management By-law | Southwest...
Jun 2, 2021 - Waste Management By-law/Collection and Disposal of Solid Waste and Recyclable Materials
solid wasterecyclable materialsby lawcollectiondisposal
https://puslinch.ca/calendar/2014-07-24-proposed-development-charges-by-law/
Proposed Development Charges By-Law - Township of Puslinch
proposed developmentby lawchargestownshippuslinch
https://www.whitewaterregion.ca/services/planning/zoning-by-law/zoning-by-law-24-01-1655-9233.html
Zoning By-Law 24-01-1655 - Whitewater Region
by lawzoningwhitewaterregion
https://magnetawan.com/government/by-laws/sixteen/magnetawan-by-law-2016-21-automatic-aid-agreement-sundridge-stro
Magnetawan-By-law-2016-21-Automatic-Aid-Agreement-Sundridge-Strong - Municipality of Magnetawan
by law
https://ejstatebystate.org/
Environmental Justice State by State Law Library & Database
Comprehensive online law library and database highlighting achievements, laws, policies, and mapping tools advancing Environmental Justice at the state level
environmental justiceby lawstatelibrarydatabase
https://assignmenttask.com/law/criminology-assignment-help.html
Criminology Assignment Help & Writing Service by Law Experts
Get professional criminology assignment help and writing service online to grab HD grades by high qualified law assignment writers, experts and researchers at...
criminology assignment helpwriting serviceby lawexperts
https://www.dryden.ca/media-manager/media-pages/by-laws/building-by-law/
Building By-law | City of Dryden
by lawcity ofbuildingdryden
https://savaastrata.com.au/compliance-and-by-law/
Compliance and By-Law - Savaa Strata Management
Jan 3, 2024 - At SAVAA Strata, we understand the importance of adhering to legal requirements and fostering a harmonious living environment within your strata community.
by lawcompliancestratamanagement
https://pod.3cr.org.au/news/done-law-trivia-night-4
Done By Law TRIVIA NIGHT | 3CR Community Radio
Aug 15, 2023 - This year, Done By Law's legendary trivia night returns yet again to light up the social calendars of the best and brightest minds in Melbourne. Expect another...
by lawtrivia nightdonecommunityradio
https://www.waterutilitysolutions.co.za/2022/08/23/cape-town-water-law-exemption/
Water By-Law Exemption: Everything you need to know to Apply!
Jul 14, 2025 - Cape Town Water by-law Exemption! Apply for exemption from the water laws enforcing private isolation valves and sub-metering installations!
everything you need to knowby lawwaterexemptionapply
https://legalrant.com/by-law-when-is-the-last-day-to-pay-rent/
Deadline to Pay Rent by Law: Last Day of the Month
Jul 19, 2024 - When renting a property, understanding the legal deadline for rent payment is crucial. The rent payment deadline is typically specified in the lease..
pay rentby lawlast dayof thedeadline
https://renewif.com/faq-items/is-eo-insurance-required-by-law/
Is E&O insurance required by law? | Renew Insurance and Financial Services
Aug 17, 2024 - Frequently Asked Insurance Questions Answered by Renew Insurance and Financial Services. USA trucking insurance experts.
required by lawinsurance
https://chicagounbound.uchicago.edu/uclrev/vol37/iss3/1/
"Front Matter" by Law Review Editors
By Law Review Editors, Published on 03/01/70
front matterby lawrevieweditors
https://www.saimm.co.za/about-saimm/constitution-and-by-laws?start=5
BY-LAW E - Page 6 - Results from #5
The SAIMM is a professional institute with local and international links aimed at assisting members source information about technological developments in the...
by lawresults from
https://www.floridareviews.com/are-breaks-required-by-law-in-florida/
Are Breaks Required By Law In Florida? - Florida Review Guide
Mar 23, 2026 - Breaks are not required by law in Florida for adult employees. However, if an employer offers meal and rest breaks, they must comply with federal labor laws...
required by lawin floridabreaksreviewguide
https://www.techtypical.com/news/doublevpn-take-down/
DoubleVPN taken down by law enforcement - TechTypical
Aug 11, 2021 - A collective effort by the US, UK, Canadian and European authorities, has taken down DoubleVPN - a provider associated with cyberattacks. User logs seized.
down by lawtakenenforcementtechtypical
https://pe.211.ca/by-law
Resources tagged with 'by-law' | 211 PEI
Let's find the help you need. Search United Way's 211 PEI database for programs available across PEI. Or call 24/7 by dialing 2-1-1.
by lawresourcestaggedpei
https://www.northmiddlesex.on.ca/laws/law-087-2022-cemeteries
By-Law 087 of 2022 - Cemeteries | North Middlesex
Jul 30, 2025 - A By-Law to establish rules and regulations for cemeteries located within the Municipality of North Middlesex
by lawcemeteriesnorthmiddlesex
https://genieharrisonlaw.com/genie-harrison/
About Genie Harrison | Genie Harrison Attorney by Genie Harrison Law Firm
Mar 20, 2026 - Learn about Genie Harrison Attorney, a fierce advocate at Genie Harrison Law Firm, fighting for victims' justice.
about genieby lawharrisonattorneyfirm
https://puslinch.ca/2024/09/draft-stop-up-and-close-by-law-cockburn-barnside/
Draft Stop Up and Close By-law - Cockburn & Barnside - Township of Puslinch
Sep 27, 2024 - A new public notice regarding the Stop Up and Close By-law is now live.
close by
https://openbylaws.org.za/akn/za-jhb/act/by-law/2022/market/eng@2022-01-05
Market By-law, 2022 – Open By-laws
by lawmarketopenlaws
https://northbay.ca/services-payments/building-development/building-by-law-2018-53/
Building By-Law 2018-53 | City of North Bay
A By-Law to Regulate the Administration of Building Permits
by lawcity ofbuildingnorthbay
https://www.midland.ca/media-manager/media-pages/by-laws/outdoor-patio-program-by-law/
Outdoor Patio Program By-law | Town of Midland
outdoor patioby lawprogramtownmidland
https://en.bidt.digital/research-project/intrusion-into-personal-devices-by-law-enforcement-authorities/
Intrusion into personal devices by law enforcement authorities (SEpES) | bidt EN
Jan 23, 2025 - The interdisciplinary research project examines aspects of societal acceptance and the legal framework of intrusion into private devices by law enforcement...
personal devicesby lawenforcement authoritiesintrusion
https://www.strataspecialistlawyers.com.au/
Strata Lawyer NSW Solicitor By Law | SSL
by lawstratalawyernswsolicitor
https://12556514-municipality-of-bluewater.azurewebsites.net/municipal-office/by-laws/hawkers-peddlers-and-buskers-by-law/
Hawkers, Peddlers and Buskers By-Law - Municipality of Bluewater
The Municipality of Bluewater is located on the beautiful shores of Lake Huron in Ontario. It's known for its rich agricultural community, beautiful beaches...
by lawhawkerspeddlersbuskersmunicipality
https://catalogue-moncton.opendata.arcgis.com/datasets/final-by-law-z-222-18-and-schedulea
Final By-Law Z-222.18 and ScheduleA
City of Moncton - Open Data
by lawfinalz
https://stm-assoc.org/document/by-law-amendments-agm-2010/
By Law amendments AGM 2010 - STM Association
by lawamendmentsagmstmassociation
https://chicagounbound.uchicago.edu/uclrev/vol10/iss4/1/
"Front Matter" by Law Review Editors
By Law Review Editors, Published on 07/01/43
front matterby lawrevieweditors
https://cdn.halifax.ca/city-hall/legislation-by-laws/by-law-c-600
By-law C-600 | Halifax
By-law C-600, Respecting Regional Capital Cost Charges
by lawchalifax
https://www.illinoiscourts.gov/documents-and-forms/representation-by-law-students-graduates-711-forms/
Representation by Law Students-Graduates-Rule 711 | Illinois Courts
Download applications for Law Students / Graduates and other forms of representation. (Rule 711). Provided by the Office of the Illinois Courts
by lawrepresentationstudentsgraduatesrule
https://picklelake.ca/by-laws/2024-28/
By-Law #2024-28
Dec 31, 2024 - Being a By-Law to Confirm the Proceedings of the Council of the Corporation of the Township of Pickle Lake By-Law 2024-28: ConfirmatoryDownload
by law
https://www.trivvy.nl/nieuws/archives/03-2016
Nieuws - Trivvy, driven by law - specialist financieel recht
De AFM heeft in januari de agenda 2016-2018 gepubliceerd en heeft op 25 maart 2016 een nadere invulling van deze agenda gepubliceerd:...
by lawnieuwsdrivenspecialistfinancieel
https://thearchipelago.ca/by-law-enforcement
By-law Enforcement Services - Archipelago, ON
law enforcement servicesarchipelago
https://bylaws.oakville.ca/
Oakville By-law Home
by lawoakville
https://engage.ottawa.ca/private-approach-review?tool=news_feed
Private Approach By-law Review | Engage Ottawa
On April 8, 2026, the City enacted the Access By-law (No. 2026-139) to regulate pedestrian and vehicular access to private property within City highways, and...
by lawprivateapproachreviewengage
https://brooklynworks.brooklaw.edu/anniversary_buildings/3/
"1904-1928: Brooklyn Eagle Building Postcard" by Brooklyn Law School
A postcard showing the Brooklyn Eagle Building.
brooklyn eagleby lawbuildingpostcardschool
https://www.rmaf.net/p/about/2025-proposed-by-law-updates
2025 Proposed By-Law Updates
by lawproposedupdates
https://www.duiqueen.com/blog/2019/may/
Blogs from May 2019 by Law Offices of Virginia L. Landry, Inc.
May 2019 blog posts by Law Offices of Virginia L. Landry, Inc. in Aliso Viejo offer tips and news related to drunk driving. Call an Aliso Viejo Attorney today!
law offices of
https://lappe.ca/24-25-by-law/
24/25 By-Law | Lappe
by law
https://velveteyes.net/movie-stills/down-by-law/attachment/velveteyes-net_down-by-law_25/
velveteyes.net_down-by-law_25 ~ Velvet Eyes
Velvet Eyes is an independent publisher based in Paris, focused in contemporary photography and created to provide emerging artists an opportunity to share...
down by lawvelveteyes
https://www.southwestmiddlesex.ca/laws/comprehensive-fence-law
Comprehensive Fence By-law | Southwest Middlesex
Oct 12, 2021 - By-law to provide for owners of privately-owned outdoor swimming pools to erect and maintain fences.
by lawcomprehensivefencesouthwestmiddlesex
https://zuva.ai/ai-fields/disclosure-required-by-law/
Disclosure Required by Law | Zuva
Learn which jurisdictions, documents and use cases our Disclosure Required by Law field is suitable for.
required by lawdisclosure
https://www.quispamsis.ca/news-and-notices/posts/public-notice-proposed-by-law-amendment-no-036-06/
Public Notice: Proposed By-law Amendment No. 036-06 | Town of Quispamsis
Public Notice is hereby given that the Quispamsis Town Council intends to consider enacting By-law Amendment No. 036.06
public noticeby law
https://picklelake.ca/by-laws/2026-07/
By-Law #2026-07
Mar 24, 2026 - Being a By-Law to Confirm the Proceedings of the Council of the Corporation of the Township of Pickle Lake By-Law 2026-07: ConfirmatoryDownload
by law
https://www.cochraneobserver.ca/cochrane-announces-meeting-on-zoning-by-law-changes/
Cochrane Announces Meeting on Zoning By-law Changes
Mar 6, 2025 - Cochrane sets town meeting for March 25, 2025, to discuss zoning by-law changes for storage containers and trailers.
by lawcochraneannouncesmeetingzoning
https://maps.grey.ca/datasets/on-farm-and-rural-business-listing-business-zoning-by-law-amendments
On-Farm and Rural Business Listing - Business Zoning By-law Amendments
On-farm and rural business listings associated with zoning by-law amendments.
on farmrural businessby lawlistingzoning
https://www.trivvy.nl/nieuws/archives/09-2019
Nieuws - Trivvy, driven by law - specialist financieel recht
Er is een consultatie voor het implementatiebesluit in verband met de vijfde anti-witwasrichtlijn . Dit besluit is onder meer van belang voor partijen die...
by lawnieuwsdrivenspecialistfinancieel
https://kodansha.us/series/kei-x-yaku-bound-by-law/volume-12/
Kei X Yaku: Bound By Law Volume 12 - Kodansha
Nov 19, 2025 - Opposite sides of the law flirt with danger—and each other—in a tangled web of political intrigue that is fraught with deception and secrets. A suspenseful...
bound by lawkeixyakuvolume
https://iqaluit.ca/content/ambulance-services-law-amendment-825
Ambulance Services By-law Amendment #825 | City of Iqaluit
ambulance servicesby lawcity ofamendmentiqaluit
https://www.anz.com.au/privacy/centre/information-required-law/
Collecting information required by law | ANZ
required by lawcollecting informationanz
https://en.munogden.ca/public-notices--info/by-law-n-2022070212rv
By-law n 2022.07.02.12Rv - OGDEN
Notice is hereby given that the Municipality of Ogden at a meeting of council held March 14. 2022 passed By-law n 2022.07.02.12Rv amending Zoning By-law No....
by lawn
https://open.moncton.ca/datasets/z-220-2-zoning-by-law-605-caledonia-rd-website
Z-220.2 Zoning By-law - 605 Caledonia Rd - Website
City of Moncton - Open Data
by lawzcaledoniard
https://www.trivvy.nl/crowdfunding-en-comppliance.html
Crowdfunding en Compliance - Trivvy, driven by law - specialist financieel recht
Crowdfunding, fintech
by lawcrowdfundingencompliancespecialist
https://www.solicitorsjournal.com/sjarticle/new-property-form-launched-by-law-society
New property form launched by Law Society
A revised property transaction form has been introduced by the Law Society to improve clarity and usability
new propertyby lawformlaunchedsociety
https://augusta.ca/bylaws/3768-2025-amend-by-law-3759-2025-fees-charges-by-law/
3768-2025 Amend By-Law 3759-2025 (Fees & Charges By-Law) - Augusta Township
by lawamendfeeschargesaugusta
https://chicagounbound.uchicago.edu/uclrev/vol33/iss1/6/
"The Coercive Function of Civil Contempt" by Law Review Editors
By Law Review Editors, Published on 09/01/65
civil contemptby lawfunctionrevieweditors
https://iqaluit.ca/content/solid-waste-amendment-law-635-eng
Solid Waste Amendment By Law #635 ENG | City of Iqaluit
solid wasteby lawcity ofamendmenteng
https://www.radio786.co.za/city-by-law-enforcement-criticised/
City by-law enforcement criticised - Radio 786
Jan 12, 2022 - The City of Cape Town says that the death of Dumisani Joxo, a homeless man, followed an altercation with Law Enforcement officers.
by lawcityenforcementcriticisedradio
https://peelregion.ca/by-laws/by-law-number-41-2025
BY-LAW NUMBER 41-2025 - peelregion.ca
by lawnumberca
https://opendatakingston.cityofkingston.ca/datasets/schedule-b-wellhead-protection-area-kingston-zoning-by-law-2022-62
Schedule B - Wellhead Protection Area: Kingston Zoning By-Law (2022-62)
Wellhead Protection Area for Cana as described Kingston Zoning By-Law 2022-62
schedule bwellhead protectionby lawarea
https://www.korseries.com/tag/love-by-law-kbs/
Love By Law KBS - Korseries
by lawlovekbs
https://velveteyes.net/movie-stills/down-by-law/attachment/velveteyes-net_down-by-law_20/
velveteyes.net_down-by-law_20 ~ Velvet Eyes
Velvet Eyes is an independent publisher based in Paris, focused in contemporary photography and created to provide emerging artists an opportunity to share...
down by lawvelveteyes
https://www.townofbeausejour.com/p/beausejour-zoning-by-law-project
Town of Beausejour - Town of Beausejour Zoning By-law Project
Welcome to the official site for the Town of Beausejour. Beausejour is a town in the province of Manitoba, located in the Rural Municipality of Brokenhead. We...
by lawtownbeausejourzoningproject
https://www.myhuntsville.ca/draft-discharge-of-firearms-by-law
Draft Discharge of Firearms By-law | MyHuntsville
The Town of Huntsville is looking for feedback regarding the Draft Discharge of Firearms By-law in Huntsville. View the components of the new Draft Discharge...
by lawdraftdischargefirearms
https://www.arran-elderslie.ca/building-and-economic-development/planning-services/zoning-by-law/
Zoning By-Law | Municipality of Arran Elderslie
Property zoning information for the Municipality of Arran-Elderslie.
by lawzoningmunicipalityarranelderslie
https://www.trivvy.nl/afm.html
AFM - Trivvy, driven by law - specialist financieel recht
by lawafmdrivenspecialistfinancieel
https://www.northstarmoving.com/testimonials/law-office-ofarthur-l-stein/
Review by Law Office of Arthur L. Stein
Aug 17, 2018 - I want to take this opportunity to commend your company on its efficiency and quality of work...The young men who came to do the work...were courteous,...
by lawreviewofficearthurstein
https://www.norfolkcounty.ca/council-administration-and-government/by-laws-and-policies/by-law-directory/littering-by-law/
Littering By-law | Norfolk County
by lawlitteringnorfolkcounty
https://cdn.halifax.ca/city-hall/legislation-by-laws/by-law-h-700
By-law H-700 | Halifax
By-law H-700, Respecting the Establishment of a Heritage Conservation District for Schmidtville
by lawh
https://kb.wisc.edu/acstaff/34434
ASA Document 325. ASPRO campus by-law changes 3-04
by lawasadocumentasprocampus
https://www.stormsurgeofreverb.com/tags/down-law
Down by Law | Storm Surge of Reverb
down by lawstorm surgereverb
https://askmyauto.com/are-spare-tires-required-by-law/
Are Spare Tires Required by Law? A Comprehensive Guide - Ask My Auto
Oct 7, 2025 - Spare tire requirements vary by location, with no universal law mandating them. Some U.S. states and many countries, particularly in the EU and Australia,...
required by lawspare tires
https://liveprospectus.com/work/instagram-shot-by-law-withgrace-be609e94-3814-4472-8100-593a8bd92ffd
Instagram shot by law_withgrace
by lawinstagramshot
https://www.lawteacher.net/free-law-essays/business-law/a-company-law-essays.php
A Company is an Artificial Person Created by Law | LawTeacher.net
The incorporation of a company is an artificial entity recognized by the law as a legal person that exists independently. This paper analyses the development...
a companycreated byartificial
https://redemmas.org/titles/9413-bound-by-law-tales-from-the-public-domain-new-expanded-edition/
-- Bound by Law?: Tales from the Public Domain, New Expanded Edition --
Buy from Red Emma's, a worker-owned radical bookstore
bound by lawthe public domaintales from
https://malonefg.com/faq-items/is-eo-insurance-required-by-law/
Is E&O insurance required by law? | Malone Financial Group
Aug 17, 2024 - Frequently Asked Insurance Questions Answered by Malone Financial Group. Business insurance experts.
required by lawinsurancemalonefinancialgroup
https://3cr2.insights.net.au/donebylaw
Done By Law | 3CR Community Radio
Sep 25, 2025 - DONE BY LAW is grassroots radio for social justice on community radio station 3CR in Melbourne, Australia. We have been on the air since 1980, giving listeners...
by lawdonecommunityradio
https://openbylaws.org.za/akn/za-jhb/act/by-law/2004/credit-control-debt-collection/eng@2005-05-23
Credit Control and Debt Collection By-law, 2004 – Open By-laws
credit controldebt collectionby law
https://www.hamilton.ca/build-invest-grow/planning-development/zoning/zoning-by-law-05-200
Zoning By-law 05-200 | City of Hamilton
by lawcity ofzoninghamilton
https://en.munogden.ca/public-notices--info/by-law-n-2022070237ld
By-law n 2022.07.02.37ld - OGDEN
Notice is hereby given that the Municipality of Ogden at a meeting of council held March 14,2022 passed By-law n 2022.07.02.37ld amending Zoning By-law No....
by lawn
https://www.centrewellington.ca/news/posts/public-notice-by-law-2024-25/
Public Notice By-law 2024-25 | Township of Centre Wellington
public noticeby lawtownshipcentrewellington