https://eic.ec.europa.eu/news/call-tenders-eic-corporate-partnership-programme-30-2023-09-15_en
Call for Tenders: EIC Corporate Partnership Programme 3.0 - European Innovation Council
EISMEA launched new tender for the future European Innovation Council Corporate Partnership Programme 3.0
call for tenderscorporate partnership
https://cordis.europa.eu/article/id/24484-call-for-tenders-ist-evaluation-and-monitoring
Call for tenders: IST evaluation and monitoring | News | CORDIS | European Commission
The Commission's Information Society and Media DG has published a call for tenders in relation to the evaluation and monitoring of...
call for tendersevaluation and monitoringist
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/77781793-6c48-4e36-8a06-ae838e2aa94b
Call for tenders for a contact and coordination centre for parentsMediaLotsen in Schleswig-Holstein...
call for tenderscontact and
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/96c36af0-7345-410e-9ea9-4d5707b78d28
4812540 Electrical distribution and control apparatus (Open call for tenders) - EU tenders -...
call for tenderselectrical distributioncontrol
https://pr.euractiv.com/pr/call-tenders-complete-renewal-website-and-content-management-system-92342
Call for tenders: Complete renewal of website and content management system | EURACTIV PR
Caritas Europa is planning a complete renewal of its current website and content management system (CMS) to fit the new structures within which the network is...
call for tenderswebsite and content
https://westmed-initiative.ec.europa.eu/call-for-tenders-eu4ocean-coalition-for-ocean-literacy/
Call for Tenders "EU4Ocean Coalition for Ocean Literacy": Deadline 29 August 2025 - WestMED
Jun 24, 2025 - A new EMFAF call for tenders is open! The main goal of this service contract is to strengthen ocean literacy across the European Union, positioning it as a...
call for tendersocean literacy
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/ec096f9d-6d3d-4bfb-b598-e8c5468428fa
Call for tenders for catering services for the Waischenfeld research campus - EU tenders -...
call for tenderscatering serviceswaischenfeldresearchcampus
https://cordis.europa.eu/article/id/28626-corrigendum-call-for-tenders-on-vaccine-effectiveness
Corrigendum: call for tenders on vaccine effectiveness | News | CORDIS | European Commission
The European Centre for Disease Prevention and Control has published a corrigendum to its call for tenders of 10 October 2007 on pandemic...
call for tenderscorrigendum
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/73c51b2f-3f19-41e2-965b-1a42caf06985
Call for tenders for the award of IPG, LAINF and LAINF supplementary health insurance benefits - EU...
call for tenders
https://cordis.europa.eu/article/id/18707-study-on-motor-vehicle-tyres-call-for-tenders
Study on motor vehicle tyres - call for tenders | News | CORDIS | European Commission
The European Commission has published a call for tenders for a study on motor vehicle tyres and related aspects.The objective of the...
call for tendersmotor vehicle
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/c25fda3a-b367-42ba-bcab-b860359d40a7
Site management and maintenance services (international open call for tenders) - EU tenders -...
management and maintenanceinternational open callsiteservices
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/79d1da1f-79a5-4085-b454-2c04d4439140
Call for tenders for the award of a contract for the provision of medical health services under a...
call for tenders
https://hadea.ec.europa.eu/news/eu4health-call-tenders-supporting-implementation-new-soho-regulation-2025-09-17_en
EU4Health call for tenders: Supporting the implementation of the new SoHO regulation - European...
HaDEA has published the call for tenders HADEA/2025/OP/0043 - Support the implementation of the new Substances of Human Origin (SoHO) Regulation 1938/2024,...
call for tenders
https://www.eulisa.europa.eu/procurement/call-tenders-lisa2024op0003
Call for tenders LISA/2024/OP/0003 | eu-LISA
Provision of temporary workers
call for tenderslisaopeu
https://cordis.europa.eu/article/id/25738-survey-on-entrepreneurship-in-higher-education-call-for-tenders
Survey on entrepreneurship in higher education - call for tenders | News | CORDIS | European...
The European Commission's Enterprise and Industry DG has published a call for tenders for a survey on entrepreneurship in higher...
call for tenderson entrepreneurshiphigher education
https://cordis.europa.eu/article/id/18522-call-for-tenders-for-internet-audience-measurement
Call for tenders for Internet audience measurement | News | CORDIS | European Commission
The European Commission's Information Society DG has issued an open call for tenders for an Internet audience measurement service in...
call for tendersaudience measurementinternetnewscordis
https://hadea.ec.europa.eu/news/eu4health-call-tenders-administrative-and-secretarial-support-implementation-initiatives-digital-2025-08-01_en?prefLang=cs
EU4Health call for tenders: Administrative and secretarial support for the implementation of...
HaDEA has published the EU4Health call for tenders HADEA/2025/OP/0034 - Administrative and secretarial support for the implementation of initiatives on digital...
call for tenderssecretarial supportadministrative
https://cordis.europa.eu/article/id/21597-monitoring-gender-equality-in-the-ist-programme-call-for-tenders
Monitoring gender equality in the IST programme - call for tenders | News | CORDIS | European...
The European Commission has published a call for tenders for monitoring progress towards gender equality in the information society...
call for tenders
https://www.timeshighereducation.com/news/corrigendum-to-call-for-tenders-for-submission-and-evaluation-of-fp6-proposals/167440.article
Corrigendum to call for tenders for submission and evaluation of FP6 proposals | Times Higher...
call for tenders
https://digital-markets-act.ec.europa.eu/dma-call-tenders-study-interoperability-tools-digital-single-market-2024-06-25_en
CALL FOR TENDERS FOR A STUDY OF INTEROPERABILITY TOOLS IN THE DIGITAL SINGLE MARKET
The European Commission is launching a call for tenders for a study into interoperability tools in the digital single market in the context of the Digital...
call for tenders
https://cordis.europa.eu/article/id/25782-call-for-tenders-benchmarking-intelligent-vehicle-systems-activities
Call for tenders - benchmarking intelligent vehicle systems activities | News | CORDIS | European...
The European Commission has published a call for tenders for the benchmarking of activities for promoting and deploying intelligent...
call for tendersvehicle systemsactivities newsbenchmarkingintelligent
https://data.mendeley.com/datasets/2mpk7tfpxd/1
Call-for-tenders & Companies Synthetic Data - Mendeley Data
This data forms synthetic data reflecting mainstream usage scenarios elicited from practitioners in the manufacturing domain, where real company data is...
call for tenderssynthetic datacompaniesmendeley
https://futurium.ec.europa.eu/sk/border-focal-point-network/posts/call-tenders-production-handbook-cross-border-energy-communities
Call for tenders: production of a Handbook on cross-border energy communities | Futurium
The Call for Tenders for the production of a Handbook on cross-border energy communities is now out!
call for tenders
https://cordis.europa.eu/article/id/23353-call-for-tenders-to-provide-research-statistics
Call for tenders to provide research statistics | News | CORDIS | European Commission
The European Commission has published an invitation to tender for the provision of statistical information services to Eurostat in the...
call for tendersresearch statisticsprovide
https://www.cdt.europa.eu/en/call-tenders-1
Call for tenders | Translation Centre For the Bodies of the EU
Translation and post-editing services of standardised technical texts in the field of Intellectual Property Rights (European Union Trade Marks (EUTM)) from...
call for tenderstranslation centrebodieseu
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/30286205-a209-469c-b451-432509202a1d
4533054 Performance of pharmacogenetic tests (open call for tenders) - EU tenders - Publications...
call for tendersperformancepharmacogenetictests
https://cordis.europa.eu/article/id/20196-call-for-tenders-for-a-study-on-innovation-in-the-pharmaceutical-sector
Call for tenders for a study on innovation in the pharmaceutical sector | News | CORDIS | European...
The European Commission's Enterprise DG has published a call for tenders for a study on the levels of innovation in the European...
call for tenders
https://atlantic-maritime-strategy.ec.europa.eu/en/funding/calls/emfaf-call-tenders-study-blue-carbon-certification-developing-certification-rules
EMFAF Call for Tenders | "Study on Blue Carbon Certification - developing certification rules for...
A new call for tenders was launched by CINEA to support a
call for tenderson bluecarbon certificationemfafstudy
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/910e6805-bb7e-3bed-ad78-b1d74916136d
Public European call for tenders for school furniture for SCOT - EU tenders - Publications Office...
call for tendersschool furnitureeu publicationseuropean
https://cordis.europa.eu/article/id/851-libraries-programme-results-of-first-call-for-tenders
Libraries programme: Results of first call for tenders | News | CORDIS | European Commission
The Libraries programme, part of the specific RTD programme for Telematics systems in areas of general interest (1990-1994), made a first...
call for tenderslibraries programme
https://eic.ec.europa.eu/news/call-tenders-eic-innovation-procurement-programme-2023-03-10_en
Call for tenders: EIC Innovation Procurement Programme - European Innovation Council
The European Innovation Council (EIC) is embarking on its new Business Acceleration Services (BAS) innovation procurement programme.
call for tendersinnovation procurementeicprogrammeeuropean
https://cordis.europa.eu/article/id/17720-commission-cancels-call-for-tenders-for-study-on-environmental-crime
Commission cancels call for tenders for study on environmental crime | News | CORDIS | European...
Invitation to tender notice no. ENV.A.3/ETU/2001/0094, published in the 'Supplement to the Official Journal of the European Communities'...
call for tenders