Robuta

https://christie.openrepository.com/entities/publication/f8412c6b-8a9f-4d77-957d-30736935ae56 Preliminary data on safety, cellular kinetics and anti-leukemic activity of UCART19, an allogeneic... cellular kineticspreliminarydatasafetyanti https://unifind.unisr.it/resource/item/3480?language=en-US UniSR - UNIFIND - Study of cellular kinetics in oral leukoplakia. [Studio della cinetica cellulare... Unifind is a portal where you can discover the expertise within a university by searching among experts, courses, professions, people, publications, and... cellular kineticsstudyoralleukoplakiastudio https://eprints.soton.ac.uk/491207/ Distinct early cellular kinetics in participants protected against colonization upon Bordetella... cellular kineticsdistinctearlyparticipantsprotected https://repositori.upf.edu/items/946d922c-40d6-4174-8cf4-6b0e69796349 e-Repositori UPF :: High-resolution kinetics and cellular determinants of SARS-CoV-2 antibody... Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) studies usually rely on cross-sectional data of large cohorts but limited repeated samples,... high resolutionrepositoriupfkineticscellular https://pubblicazioni.unicam.it/handle/11581/112874 The role of structural factors in the kinetics of cellular uptake of pyrazoloacridines and... role ofstructuralfactorskineticscellular