https://www.india.com/entertainment/mana-shankara-varaprasad-garu-collection-day-5-chiranjeevi-nayanthara-starrer-continues-its-strong-hold-at-the-box-office-crosses-rs-120-crore-mark-8270778/
Mana Shankara Varaprasad Garu Collection Day 5: Chiranjeevi, Nayanthara starrer continues its strong hold at the box office, crosses Rs 120 crore mark
manashankaravaraprasadgarucollection
https://www.hindustantimes.com/entertainment/telugu-cinema/mana-shankara-vara-prasad-garu-trailer-chiranjeevi-tries-hard-to-woo-nayanthara-venkatesh-makes-mass-entry-watch-101767522561244.html
Jan 4, 2026 - Mana Shankara Vara Prasad Garu trailer: Anil Ravipudi's Sankranthi release stars Chiranjeevi and Nayanthara in lead roles.
manashankaravaraprasadgaru
https://www.financialexpress.com/life/entertainment-mana-shankara-varaprasad-garu-box-office-collection-day-5-chiranjeevi-starrer-crosses-rs-200-cr-worldwide-in-5-days-4110515/
Chiranjeevi has reaffirmed his unmatched box office pull with Mana Shankara Vara Prasad Garu, which has crossed Rs 200 crore globally within just five days of...
box officemanashankaravaraprasadgaru
https://tv9telugu.com/entertainment/tollywood/senior-actor-nassar-on-chiranjeevis-kindness-friendship-journey-1714466.html
Jan 5, 2026
chiranjeevi
https://www.timesnownews.com/videos/entertainment/bollywood-news/chiranjeevis-shocking-comment-on-wanting-ram-charan-to-have-a-son-have-a-boy-so-our-legacy-video-118180624
Megastar Chiranjeevi has sparked controversy with his recent comment about wanting his son Ram Charan to have a male child. Chiranjeevi expressed his desire...
ram charanchiranjeevishockingcommentwanting
https://www.india.com/topic/chiranjeevi-on-deepfake-video/
Get latest Chiranjeevi On Deepfake Video news updates & stories. Explore Chiranjeevi On Deepfake Video photos and videos on India.com
deepfake videolatest newschiranjeevivideosphotos
https://www.indiatoday.in/movies/regional-cinema/story/chiranjeevi-london-lifetime-achievement-honour-2695018-2025-03-18
Megastar Chiranjeevi arrived in Heathrow ahead of the award ceremony in London. He will be honoured with the Lifetime Achievement award by London MPs.
warm welcomein londonlifetime achievementchiranjeevireceives
https://www.indiatvnews.com/entertainment/music/acharya-bhale-bhale-banjara-out-chiranjeevi-ram-charan-outshine-in-peppy-song-latest-celeb-news-2022-04-18-770635
As Chiranjeevi and Ram Charan sizzle in a very composed and stylized manner, the steps for 'Bhale Bhale Banjara' have been kept classy.
acharya sfather sonbanjaraduochiranjeevi
https://www.pinkvilla.com/entertainment/south/rajinikanth-mohanlal-akshay-kumar-hema-malini-mithun-chakraborty-and-chiranjeevi-pose-for-blockbuster-photo-at-waves-2025-1385359
May 1, 2025 - Waves 2025 turns into a star-studded affair as celebrities from across regional industries come together for a grand group photo.
akshay kumarhema malinimithun chakrabortyrajinikanthmohanlal
https://www.rediff.com/movies/report/celebrating-chiranjeevis-birthday/20190822.htm?print=true
A day after the trailer release of his magnum opus Sye Raa Narasimha Reddy, Chiranjeevi celebrated his 64th birthday. | Celebrating Chiranjeevi's Birthday!
celebratingchiranjeevibirthdayrediffcom
https://www.india.com/entertainment/class-of-80s-mohanlal-chiranjeevi-jackie-shroff-jaya-prada-and-other-top-stars-pose-for-a-viral-photo-3857670/
Giving a glimpse of his new lavish house, South superstar Chiranjeevi hosted a formal reunion with a black & gold theme named 'class of 80s' at his new...
jackie shroffjaya pradaclassmohanlalchiranjeevi
https://indianexpress.com/article/entertainment/telugu/mana-shankara-vara-prasad-garu-box-office-collection-day-1-update-chiranjeevi-film-earns-rs-44-cr-10469683/
Mana Shankara Vara Prasad Garu Box Office Collection Worldwide Day 1,: On Monday, its first day of release, the Chiranjeevi film earned around Rs 28.50 crore...
box officemanashankaravaraprasad
https://economictimes.indiatimes.com/news/chiranjeevi-nagarjuna-allu-aravind-hold-discussions-with-anurag-thakur-on-film-industry/articleshow/98276842.cms?from=mdr
Chiranjeevi was presented 'Film personality of the year' award at the International Film Festival of India (IFFI) at Goa in November last year. Chiranjeevi...
anurag thakurallu aravindchiranjeevinagarjunahold
https://www.news9live.com/entertainment/telugu/mana-shankara-vara-prasad-garu-trailer-out-chiranjeevi-lights-up-screen-with-family-blockbuster-2916969
Jan 4, 2026 - Megastar Chiranjeevi woos fiery Nayanthara in Anil Ravipudi's hilarious Sankranti laugh riot. From RAW agent to romance pleas, Venkatesh's mass entry steals...
lights upmanashankaravaraprasad
https://www.newindianexpress.com/entertainment/telugu/2026/Jan/28/telugunews2026jan26chiranjeevi-gives-special-gift-to-anil-ravipudi-after-mana-shankara-vara-prasad-garus-success
After delivering Chiranjeevi a career-best success with Mana Shankara Vara Prasad Garu, director Anil Ravipudi received an expensive gift from the megastar
special giftanil ravipudichiranjeevigivesmana
https://gulfnews.com/entertainment/south-indian/ram-charan-upasana-konidela-blessed-with-twins-chiranjeevi-calls-it-a-moment-of-pure-joy-1.500427580
Tollywood star Ram Charan and Upasana Konidela welcome twins, a boy and a girl, bringing immense joy to their family. Chiranjeevi shares the happy news,...
ram charanpure joyupasanawelcometwins
https://www.indiatimes.com/entertainment/celebscoop/who-is-munawar-faruquis-girlfriend-nazila-chiranjeevi-slams-mansoor-ali-khan-more-from-ent/articleshow/126712531.html
From Munawar Faruqui's Girlfriend Nazila's cryptic post about Bigg Boss 17 to Chiranjeevi slamming Mansoor Ali Khan, here is all that rocked the world of...
who ismunawar faruquigirlfriendchiranjeevislams
https://www.hindustantimes.com/entertainment/telugu-cinema/mana-shankara-varaprasad-garu-box-office-collection-day-5-chiranjeevi-film-crosses-120-crore-101768580964943.html
Jan 17, 2026 - Mana Shankara Varaprasad Garu box office collection day 5: Chiranjeevi's action entertainer has refused to slow down at the weekdays despite competition.
box officemanashankaravaraprasadgaru
https://chiranjeeviindia.com/about/
About UsWe Provide The Best For Your Business Chiranjeevi Group of Companies stands as a testament to entrepreneurial excellence, innovation, and a commitment...
group of companieschiranjeevi
https://www.indiatoday.in/movies/regional-cinema/story/sye-raa-narasimha-reddy-war-scene-rs-54-crore-1351914-2018-09-28
The makers of Sye Raa Narasimha Reddy have spent a whopping Rs 54 crore on an eight-minute war sequence in the film.
sye raanarasimha reddychiranjeevispendsrs