Robuta

https://www.jesuswasaliberal.org/ Jesus was a Liberal | A View from the Liberal Side of Christianity jesus was a liberalfrom the sideviewchristianity https://www.christianitytoday.com/ Christianity Today - Seek the Kingdom. Jul 30, 2026 - Christianity Today provides thoughtful, biblical perspectives on theology, church, ministry, and culture on the official site of Christianity Today magazine. christianity todayseekkingdom https://www.christianity.com/bible/daily-bible-verse/ Bible Verse of the Day - Daniel 4:37 | Encouraging Daily Scripture Reading | Christianity.com Bible Verse of the Day for 5/15, Daniel 4:37 - Read today's daily scripture, share with friends, and discover related Bible verses and devotionals. bible verse of the day https://www.premierchristianity.com/ Premier Christianity Magazine Premier Christianity magazine - The UK’s leading Christian magazine. Be equipped, inspired and informed from a Christian perspective. Find out more... premier christianitymagazine https://www.johnsanidopoulos.com/ ORTHODOX CHRISTIANITY THEN AND NOW orthodox christianity https://glory2godforallthings.com/ Glory to God For All Things - Orthodox Christianity, Culture and Religion, Making the Journey of... Orthodox Christianity, Culture and Religion, Making the Journey of Faith glory to god for all things https://www.christiantoday.com/ Christian News on Christian Today, Latest Religious News, News About Christianity - Christian Today Christian Today is the UK's largest online Christian news provider, with the latest in-depth reports. Christian news, Updated daily. christian newson todaylatestreligiouschristianity https://evidenceforchristianity.org/ Evidence for Christianity – Evidence for Christianity Website evidence for christianity https://www.kithcartcodeofsilence.com/ History of Tithing in Christianity - Jonathan Kithcart Jun 15, 2026 - Explore the History of Tithing in Christianity through biblical history, church tradition, Pope Leo III, Charlemagne, and the evolution of... history oftithingchristianityjonathan https://www.lcg.org/ Living Church of God - Discover original Christianity, as taught by the Apostles View answers to important questions about life and the Bible. The Living Church of God teaches original Christianity, the good news of Jesus Christ's coming... living church of goddiscover original https://www.christianity.com/ Christianity - The History, Beliefs, and Teachings of Faith in Jesus Christ | Christianity.com Learn all about the beliefs, facts, history and origin of Christianity. Featuring thousands of questionis and answers to help you understand the Bible and live... faith in jesus christbeliefs and teachingsthe history https://defendingchristianity.com/ Defending Christianity defendingchristianity https://leohohmann.com/ LeoHohmann.com – Investigative reporting on globalism, Christianity, Islam, Judaism and where... Investigative reporting on globalism, Christianity, Islam, Judaism and where politics, culture and religion intersect. investigative reporting https://cwc-aiu.com/ Centre for World Christianity – Africa International University/NEGST Africa International University/NEGST centre for world christianityinternational universityafrica https://krisan.com/start-strong-the-book/ Start Strong: A New Believer's Guide to Christianity - Krisan Marotta Author start strongnew believer https://origins.osu.edu/history-news/separation-church-and-state-rooted-american-christianity The Separation of Church and State Is Rooted in American Christianity | Origins Many Americans are worried that America's Christian heritage is being threatened. Even if the threat is more perceptual than actual, it has mobilized important... church and statethe separation https://www.christianitydaily.com/news/israel-seeks-closer-ties-with-christian-denomination.html World News | Israel Seeks Closer Ties With Christian Denomination | Christianity Daily Israel Seeks Closer Ties With Christian Denominations Ahead of 2030 Baptism Jubilee world newsisraelseekscloser https://hcbcapologetics.com/ Defending Christianity | HCBC Apologetics Ministry HCBC Apologetics Ministry defending christianityapologeticsministry https://geochristian.com/ GeoChristian – The Earth. Christianity. They go together. The Earth. Christianity. They go together. the earthgeochristianchristianitygotogether https://realclearcatholic.com/ Real Clear Catholic – Catholicism is Complete Christianity. This website is an explanation of the... “There are not a hundred people in America who hate the Catholic Church. There are millions of people who hate what they wrongly believe to be the Catholic... real clear catholic https://christvm.com/ Home - Christianity Vs Mormonism christianityvsmormonism https://crossexamined.org/blog/ Christian Apologetics Blog | Learn Why Christianity is True | Christians Jul 17, 2025 - CrossExamined.org is an evangelical, inter-denominational Christian ministry. We seek to present evidence that the Bible is true. Learn more click here. christian apologeticslearn whyblogchristianitytrue https://www.christianitydaily.com/news/pca-general-assembly-rejects-overture-to-allow-women-as-deacons.html Church News | PCA General Assembly Rejects Overture to Allow Women as Deacons | Christianity Daily PCA General Assembly Rejects Overture to Allow Women as Ordained Deacons https://www.christianity.org.uk/ Christianity Welcome to Christianity.org.uk, Our new website is bursting with thought-provoking, balanced articles about the Christian faith. christianity https://ethosinstitute.sg/ homepage - ETHOS Institute for Public Christianity institute forhomepageethospublicchristianity https://christianity.net.au/ Christianity.net.au - God Makes Sense Does God make sense to you? Discover Him today through Christ Jesus christianityaugodmakessense https://orthochristian.com/ Orthodox Christianity orthodoxchristianity https://www.christianity.org.uk/article/the-history-of-easter The history of Easter - Christianity Easter commemorates the death and resurrection of Jesus Christ in Jerusalem 2,000 years ago, although the word 'Easter' actually has nothing to do with... the history ofeasterchristianity https://www.abnsat.com/ Christianity | Abn Sat قناة الارامية - الصفحة الرسمية | الولايات المتحدة Visit Abn Sat قناة الارامية - الصفحة الرسمية to find out more about Christianity and how it differs from Islam. Learn about Christian Discipleship. Many... christianityabnsat https://en.wikipedia.org/wiki/Criticism_of_Christianity Criticism of Christianity - Wikipedia criticismchristianitywikipedia https://follow.it/debunking-christianity Debunking-christianity News from https://debunking-christianity.com/ debunkingchristianity https://publicchristianity.org/ CPX - The Centre for Public Christianity Jul 3, 2026 - CPX is a media company that offers a Christian perspective on contemporary life. the centrefor publiccpxchristianity https://www.christianitydaily.com/news/pushpay-expands-church-engagement-capabilities.html IT News | Pushpay Expands Church Engagement Capabilities | Christianity Daily Pushpay Expands Church Engagement Capabilities with Acquisition of Nurture.io it newschurch engagementpushpayexpandscapabilities https://www.christianitydaily.com/ Christianity Daily News | Christianity Daily christianity dailynews https://artandchristianity.org/ Art + Christianity Art and Christianity seeks to foster and explore the dialogue between art, Christianity and other religious faiths. Through events, publications and... artchristianity https://faithx.events/ FAITHx ✝️ | The TED Talks of Christianity 🎤 - FAITHx ✝️ May 29, 2026 - FAITHx Vancouver 2027 Faith Culture Entrepreneurship Technology Music Worship Biblical Education Inspiring Media Anointed Speakers FAITHx Talks FAITHx A... ted talksfaithxchristianity https://ginazurlo.com/ Gina Zurlo, Ph.D. – World Christianity, quantitative social science, gender studies World Christianity, quantitative social science, gender studies quantitative social scienceph dworld christianity https://www.christianitystillmakessense.com/ Christianity Still Makes Sense christianitystillmakessense https://www.christianitytoday.com/history/ Christian History - Learn the History of Christianity & the Church - Christianity Today Mar 4, 2026 - Christian History provides quality articles about the history of the Christian Church and is the official site of Christian History Magazine. christian historylearnchristianitychurchtoday https://www.debunking-christianity.com/ Debunking Christianity Christian Apologetics, Bible, Biblical Christianity, Christian Faith, Agnostic, Evangelical, Atheism, Atheist, Creation, John W. Loftus, David Madison debunkingchristianity https://centerforpublicchristianity.org/ Home - Center for Public Christianity Mar 19, 2026 - We seek the cultural, social, and spiritual renewal of Raleigh and the Triangle by equipping, connecting, and mobilizing Christians to work for the common good... home centerfor publicchristianity https://www.christianityexplored.org/ Christianity Explored christianityexplored https://jeac.de/ojs/index.php/jeac/index Journal of Ethics in Antiquity and Christianity journalethicsantiquitychristianity https://faithandheritage.com/ Faith and Heritage Occidental Christianity for preserving Western Culture and People faith and heritagewestern cultureoccidentalchristianitypreserving https://truthtalklive.libsyn.com/podcast/introducing-christianity-to-mormons TRUTH Talk with Stu Epperson: Introducing Christianity to Mormons Stu interviews the author of the book " Eric Johnson. Learn about Eric's exciting experience, of bringing the Gospel to the Mormon community. truthtalkstueppersonintroducing https://www.tcd.ie/classics/postgraduate/mphil/early-christianity.php Early Christianity - Department of Classics - Trinity College Dublin How did Christianity develop from a marginalised and persecuted sect to the dominant religion of the Roman Empire? This module examines the first four... department of classicsearly christianitytrinity collegedublin https://www.cccw.cam.ac.uk/library/online-research-resources/ Online Research Resources - Cambridge Centre for Christianity Worldwide Apr 21, 2022 - General Internet Archive is a non-profit library of millions of free books, movies, software, music, websites, and more. Online Books Page Listing over 2 online research resourcescentre forcambridgechristianityworldwide https://collectingmythoughts.blogspot.com/2016/06/why-christianity-was-revolutionary-from.html Collecting My Thoughts: Why Christianity was revolutionary from the beginning The first century vision is breathtaking, given our divisions today. "After his death and resurrection a fellowship of foll... my thoughtswhy christianityfrom thecollectingrevolutionary https://corechristianity.libsyn.com/how-christians-should-think-about-cremation Core Christianity: How Christians Should Think About Cremation Episode 85 | Dr. Michael Horton and Adriel Sanchez answer caller questions. Key questions answered in today's show: 1. How important is it for church to be... core christianitythink aboutchristianscremation https://scrumpdillyicious.blogspot.com/2016/06/santa-casa-di-loreto-marian-heart-of.html?m=0 Scrumpdillyicious: Santa Casa di Loreto: The Marian Heart of Christianity Safely hidden on top of a hill, under the dome of the Basilica della Santa Casa di Loreto, within a magnificently decorated marble ... santa casadiloretomarianheart https://creationevolutiondesign.blogspot.com/2006/11/what-i-believe-about-creation.html?showComment=1170815700000 CreationEvolutionDesign: What I believe about Creation, Evolution, Design and Christianity I have decided to start an online list of the main things that I believe about Creation (including Christianity), Evolution and Design, in a... what i believeabout creationevolution designchristianity https://scienceavenger.blogspot.com/2007/10/preview-of-dinesh-dsouzas-whats-so.html?showComment=1193597400000 Science Avenger: Preview of Dinesh D'Souza's "What's So Great About Christianity?" Annoyed apparently by the recent thrashing Christianity has gotten in the popular bookstore these days, and no doubt havng learned well from... https://bedejournal.blogspot.com/2010/08/i-recently-received-email-several-in.html?showComment=1309547487444 Quodlibeta: Did Christianity Spell the End of Classical Civilisation? Science, religion, history, politics and writing about all of these the endchristianityspellclassicalcivilisation https://pure.psu.edu/en/publications/christianity-in-europe-and-overseas/ Christianity in Europe and overseas - Penn State in europechristianityoverseaspennstate https://markalanwilliams.libsyn.com/webpage/2016/04 Christianity Questions and Answers christianityquestionsanswers https://bibchr.blogspot.com/2008/11/dont-miss-these-11508.html?showComment=1225916280000 Biblical Christianity: Don't miss these: 11/5/08 While I'm mulling over my chair-over-the-head post, here are some notes, as well as some particularly good quotations, for your edification.... biblical christianitymiss https://takingturf.com/crush-it-w-christianity/ CRUSH IT! w/Christianity - TakingTurf.com Jul 11, 2025 - Not Saved?👇Get The Seed (Short Modules, Approx. 57 mins.) Born-Twice?✌️Grow Here👇 (Short Modules, Approx. 2.5 hrs. *Plays Through All · Menu: Top Right of... crush itwchristianitytakingturf https://bibchr.blogspot.com/2009/03/piper-and-boys-wresting-girls.html?showComment=1236708960000 Biblical Christianity: Piper and boys wrestling girls In Over My Dead Body, Son , John Piper dogmatically condemns the thought of boys wrestling girls in athletic meets. He makes two basic point... biblical christianityboys wrestlingpipergirls https://bibchr.blogspot.com/2010/11/hither-and-thither-111210.html Biblical Christianity: Hither and thither 11/12/10 Nice enough week for me. Quiet here at the blog. I've left up the Advent season post , in hopes that more will chime in. Some requested an A... hither and thitherbiblical christianity https://research.tudelft.nl/en/publications/cultures-and-christianity-ad-2000/ Cultures and Christianity A.D. 2000 - TU Delft Research Portal a dtu delftcultureschristianityresearch https://santmatradhasoami.blogspot.com/2022/06/hidden-christianity-forgotten.html Sant Mat Radhasoami: Hidden Christianity: Forgotten Scriptures, Ignored Saints, Misplaced Mystics Sant Mat Spirituality, RadhaSoami, Inner Light and Sound Meditation, Surat Shabd Yoga, the Path of the Masters, from a traditional Indian perspective sant mat radhasoamihiddenchristianity https://www.jgrchj.net/home Journal of Greco-Roman Christianity and Judaism greco romanjournalchristianityjudaism https://www.christianitytoday.com/give/?segmentCode=WEBCTHeaderLoggedOut Make a Gift - Christianity Today Jun 15, 2026 - See The Kingdom Come. In a world that groans for the kingdom of God, your generosity helps Christianity Today illuminate what it looks like to follow Jesus... make a giftchristianitytoday https://dangerousidea.blogspot.com/2009/03/some-reasons-why-christianity-makes.html?showComment=1238676480000 dangerous idea: Some Reasons why Christianity Makes Sense to Me A redated post. I wrote a comment on Debunking Christianity that I would like to share here. Victor wrote: If this is a reason to reject... some reasonswhy christianitydangerousideamakes https://www.statista.com/chart/19692/share-of-the-us-population-identifying-as-christian/ Chart: Then & Now The Decline Of Christianity In the U.S. | Statista This chart shows the share of the U.S. population identifying as Christian. then nowu schartdecline https://www.research.ed.ac.uk/en/activities/movement-as-immobility-a-conference-on-film-and-christianity/ Movement as Immobility: A Conference on Film and Christianity - University of Edinburgh Research... https://counago-and-spaves.blogspot.com/2006/06/something-about-scientology-versus.html Counago & Spaves: Something about Scientology versus Christianity with Wonder Woman Somewhere in... Those Flaming Lips in action. something about https://bibchr.blogspot.com/2010/05/scientists-are-baffled.html?showComment=1274546243165 Biblical Christianity: Scientists are baffled! My friend and brother, Missionary to Honduras Mike Pettengill , sent me a series of articles with a single theme: Scientists Baffled! I've ... biblical christianityscientistsbaffled https://www.latimes.com/opinion/story/2019-12-23/christianity-today-mark-galli-donald-trump-impeachment Opinion: What took Christianity Today so long to confront Trump? - Los Angeles Times Dec 23, 2019 - Throughout Mark Galli's tenure as editor, the magazine has been in lockstep with an agenda too often inimical to the teachings of Jesus. https://ufind.univie.ac.at/en/exam.html?prueid=1421476&lv=010060&semester=2025W u:find - 010060 VO Judaism, Christianity, Islam (2025W) ufindvochristianityislam https://bibchr.blogspot.com/2008/04/mormon-coffee.html?showComment=1209481260000 Biblical Christianity: "Mormon Coffee" Among the many blessings of my dear wife and my trip to Tennessee was meeting Aaron Shafovaloff (SHOF-a-WAL-lof). Aaron is an embarrassingly... biblical christianitymormoncoffee https://www.cswc.div.ed.ac.uk/tag/korea/ Korea | Centre for the Study of World Christianity for the studykoreacentreworldchristianity https://bibchr.blogspot.com/2012/06/aog-guards-against-threats-to-gospel.html?showComment=1340290559905 Biblical Christianity: AOG guards against threats to the Gospel like atheism, Islam, Buddhism...... The Assemblies of God , that denomination which teaches that born-again Christians who don't speak in tongues can't really serve or live for... https://annsautism.blogspot.com/2018/08/autism-christianity-lgbtq-why-its.html Ann's Autism Blog: Autism, Christianity, LGBTQ. Why it's important. Safeguarding. Caring. There are different beliefs about God and what he thinks of LGBT+ people. In the Church of England, it's still a difficult subject f... autism blogannchristianity https://www.audible.com/cat/Religion-Spirituality/Christianity-Audiobooks/18574854011?/ref=a_cat_Relig_c2_3_catttl Christianity Audiobooks in Religion & Spirituality | Audible.com christianityaudiobooksreligionspiritualityaudible https://books.google.com/books?id=cUoGJSs9yOUC A History of Christianity in Indonesia - Google Books Indonesia is the home of the largest single Muslim community of the world. Its Christian community, about 10% of the population, has until now received no... history of christianityin indonesiagooglebooks https://bibchr.blogspot.com/2011/09/jonny-quest-opening-titles-recreated.html Biblical Christianity: Jonny Quest opening titles recreated with stop-motion figures When I was a kid, I loved Jonny Quest . The opening sequence caught the feel of the cartoon show pretty well. Here's a reminder: Now Roge... biblical christianityjonny questopening titlesstop motion https://koenraadelst.blogspot.com/2014/05/a-hindu-argues-circles-around.html Koenraad Elst: A Hindu argues circles around Christianity What Every Hindu Should Know about Christianity (Wilmington, Delaware, 2014) is a book by Kalavai Venkat, pen name of a compute... koenraad elsthinduarguescirclesaround https://culturecampaign.blogspot.com/2008/05/public-school-textbooks-favor-islam.html CULTURE NEWS: Public School Textbooks Favor Islam over Christianity In promotion of Islam, children are taught that "jihad" to Muslims means "doing good works" UPDATE 8/3/13: Islam Favored over Christianit... culture newspublic schooltextbooksfavorislam https://experimentaltheology.blogspot.com/2009/08/bait-and-switch-of-contemporary.html?showComment=1250087452543 Experimental Theology: The Bait and Switch of Contemporary Christianity To start, a story. A few years ago a female student wanted to visit with me about some difficulties she was having, mainly with her family l... bait and switchexperimentaltheologycontemporarychristianity https://books.google.com/books?id=orUCAAAAQAAJ&hl=hr&source=gbs_book_other_versions_r&cad=1 Philosophical and Critical Inquiries Concerning Christianity - Charles Bonnet - Google Knjige philosophicalcriticalinquiriesconcerningchristianity https://daattorah.blogspot.com/2021/06/avoiding-christianity.html Daas Torah - Issues of Jewish Identity: Avoiding Christianity Avoda Zara (16b) Our Rabbis taught: When R. Eliezer was arrested because of Minuth they brought him up to the tribune to be judged. Sai... daas torahjewish identityissuesavoidingchristianity https://okra.stanford.edu/link/document530809-001 ''Communism's Challenge to Christianity'' - Online King Records Access (OKRA) - The Martin Luther... https://bibchr.blogspot.com/2013/06/yeah-but-dude-youre-no-spurgeon.html Biblical Christianity: "Yeah, but dude, you're no Spurgeon" [This is a companion-piece to the post today at Pyro , and to this sermon .] The best three-word non-explanation explanation I've ever hea... biblical christianityyeahdudespurgeon https://jesus-logos.blogspot.com/2013/11/answering-common-objections-to.html Logos: Answering Common Objections to the Uniqueness of Christianity - by Peter Kreeft In CERC Ronald Knox once quipped that "the study of comparative religions is the best way to become comparatively religious." ... common objectionsto the https://bibchr.blogspot.com/2009/05/forget-pc-vs-mac-what-about.html?showComment=1241747220000 Biblical Christianity: Forget PC vs Mac: what about...? The real, living, Triune God of Scripture does not confine Himself to a ghetto. He created everything, He owns everything, He is Lord over everything. That... biblical christianityforgetpcvsmac https://drupal.yalebooks.yale.edu/book/9780300125818/new-history-early-christianity New History of Early Christianity | Yale University Press new historyearly christianityyale universitypress https://en.wikipedia.org/wiki/Eastern_Christianity Eastern Christianity - Wikipedia eastern christianitywikipedia https://experimentaltheology.blogspot.com/2009/08/bait-and-switch-of-contemporary.html?showComment=1250202018482 Experimental Theology: The Bait and Switch of Contemporary Christianity To start, a story. A few years ago a female student wanted to visit with me about some difficulties she was having, mainly with her family l... bait and switchexperimentaltheologycontemporarychristianity https://regenerationandrepentance.wordpress.com/ Tree | Promoting experiential, reformational Christianity. Promoting experiential, reformational Christianity. treepromotingexperientialchristianity https://gpe.wikipedia.org/wiki/Category:Critics_of_Christianity Category:Critics of Christianity - Wikipedia categorycriticschristianitywikipedia https://publikationen.uni-tuebingen.de/xmlui/handle/10900/177354 [Rezension von: Ogereau, Julien M., 1981-, Early Christianity in Macedonia : from Paul to the late... https://reginadoman.blogspot.com/2020/12/christianity-please-hold-church.html Christianity, Please -- Hold the Church! (republished from Dec. 1, 2003) A Journal Entry for Dec. 1, 2003 for the webmag After Eden One of the more aggravating books on the best-seller list today is a potboiler ca... please holdthe churchchristianityrepublisheddec https://abudervish.blogspot.com/2016/05/ancient-manuscript-review-190-antique.html abu dervish: Ancient Manuscript Review 190 : Antique Bible / Christianity written in Classical... This is a papyrus fragment written in Classical Greek language in black ink. Origin from Egypt and purchased from Antique Store in USA ... manuscript review https://beerchristianity.libsyn.com/2-ginesis-greenbelt-festival-harry-and-chris Beer Christianity podcast: 2: Ginesis: Greenbelt festival, Harry and Chris The pub: Broadways, Didcot. The presenters: a 22-year-old feminist environmentalist and a 42-year-old Christian socialist. The beer: American and surprisingly... greenbelt festivalbeerchristianitypodcastharry https://bibchr.blogspot.com/2010/04/hither-and-thither-41610.html?showComment=1271477370631 Biblical Christianity: Hither and thither 4/16/10 Well it's been a pretty full week, and particularly brutal yesterday. (For that reason, I haven't been able to follow up some readers' tips;... hither and thitherbiblical christianity https://www.southampton.ac.uk/courses/2026-27/modules/hist2085 Rebels with a Cause: The Historical Origins of Christianity | HIST2085 | University of Southampton The first century CE saw the rise of a new world religion that was to have an ever changing and at times turbulent history up to today. This module will... rebels with a causehistorical origins https://andjustincase.blogspot.com/2013/06/christianity-and-terrorism.html Just in CASE: Christianity and Terrorism Above: Photo 2013 Boston Marathon (WikiCommons) We are often reminded that we live in a fallen world. Incidents such the Boston Maratho... just in casechristianityterrorism https://bibchr.blogspot.com/2011/03/hither-and-thither-32511.html?showComment=1301059257263 Biblical Christianity: Hither and thither 3/25/11 Cool week in a number of ways. Some time soon I will be receiving the last-before-printing galley of World-Tilting Gospel for one final go-o... hither and thitherbiblical christianity https://eternalrevolution.com/ Eternal Revolution - Pray For Revolution | Writings of author Paul Nowak on Christianity, G.K.... Writings of author Paul Nowak on Christianity, G.K. Chesterton, and Eternal Revolution.