https://www.ncbi.nlm.nih.gov/Structure/pdb/7AHZ
7AHZ: Crystal structure of Western clawed frog MDM2 RING domain homodimer bound to UbcH5B-Ub
E3 ubiquitin-protein ligase Mdm2ZINC ION
https://www.vlaanderen.be/inbo/en-gb/news-may-2026/recommendation-in-the-spotlight-african-clawed-frog/
Recommendation in the spotlight: African clawed frog | Instituut voor Natuur- en Bosonderzoek
in the spotlightafrican clawed frog
https://scienceblogs.com/zooillogix/2008/12/28/four-clawed-mutant-lobster
Four Clawed Mutant Lobster | ScienceBlogs
We (I) here at Zooillogix have a thing for lobsters. It involves Belgium, pasta tongs, and a Dutch boy named Lourens. I'll leave it at that.
fourclawedmutantlobsterscienceblogs
https://infogram.com/african-clawed-frog-xenopus-laevis-1gjk92e9r91rm16
aFRICAN CLAWED FROG (Xenopus laevis) by lucasportilho - Infogram
A picture of an African Clawed Frog. It uses its brown and grey skin to blend in with the ground.
african clawed frogxenopus laevisinfogram
https://store.steampowered.com/app/3394840/Clawed/
Clawed on Steam
Embark on a covert mission to the dinosaur theme park Prehistoria, where you must explore the park's grounds to scavenge resources, solve puzzles, and fight...
clawedsteam
https://www.animaldiversity.org/accounts/Gehyra_mutilata/classification/
Gehyra mutilata (Stump-tailed Gecko, Common Four-clawed Gecko) | CLASSIFICATION | Animal Diversity...
gehyra mutilatastumpgecko
https://canalrivertrust.org.uk/things-to-do/fishing/caring-for-our-fish/freshwater-fish-species/rare-and-protected-fish/white-clawed-crayfish
White-clawed crayfish | Rare and protected fish
The white-clawed crayfish is not technically a fish but a crustacean.
white clawed crayfishrareprotected
https://www.vlaanderen.be/inbo/publicaties/risk-assessment-for-african-clawed-frog-xenopus-laevis-daudin-1802
Risk Assessment for African clawed frog Xenopus laevis (Daudin, 1802) | Instituut voor Natuur- en...
Het INBO is het onafhankelijk onderzoeksinstituut van de Vlaamse overheid dat via toegepast wetenschappelijk onderzoek, data- en kennisontsluiting het...
https://www.ncbi.nlm.nih.gov/gene/432049
qki.L QKI, KH domain containing, RNA binding L homeolog [Xenopus laevis (African clawed frog)] -...
https://www.ncbi.nlm.nih.gov/gene?term=ENSXETG00000033030
hsf5 heat shock transcription factor family member 5 [Xenopus tropicalis (tropical clawed frog)] -...
https://www.meduniwien.ac.at/web/en/about-us/news/2024/news-in-march-2024/genetic-basis-for-the-evolution-of-hair-discovered-in-the-clawed-frog-1/
Genetic basis for the evolution of hair discovered in the clawed frog
evolution of hairfor thegeneticbasis
https://mapress.com/zt/article/view/zootaxa.5115.4.3
A new Four-clawed Gecko from limestone hills in Lopburi Province, central Thailand (Squamata,...
https://clawedforehead.com/
Clawed Forehead | Classical Metal Rock Band from the Czech Republic
metal rock bandfrom theclawedforeheadclassical
https://www.cbsnews.com/news/irs-recovers-1-billion-from-wealthy-taxpayers-audit-increase/
IRS says it has clawed back $1 billion from millionaire tax cheats - CBS News
The IRS says its push to step up audits on wealthy tax cheats is paying off, with the agency recovering more than $1 billion.
https://www.celebritynetworth.com/articles/entertainment-articles/leona-helmsley-clawed-her-way-from-factory-worker-to-queen-of-nyc-real-estate-then-went-to-jail-and-left-billions-to-charity-and-her-dog/
Leona Helmsley Clawed Her Way From Factory Worker To Queen of NYC Real Estate - Then Went to Jail...
Jul 23, 2025 - Leona Helmsley clawed her way from a Brooklyn sewing factory to the top of New York's real estate world. She married a billionaire, built a luxury hotel...
https://mymodernmet.com/humpback-whale-not-endangered/?ref=warpnews.se
The Humpback Whale Has Clawed Its Way Back From Endangered Status
Mar 11, 2022 - Humpback whales have made a comeback, remarkably removing themselves from the endangered species list in Australia.
humpback whaleclawed
https://www.fox13news.com/news/tens-of-thousands-of-nonnative-tropical-clawed-frog-pulled-from-hillsborough-rivers
'Tens of thousands' of nonnative tropical clawed frogs pulled from Hillsborough waterways | FOX 13...
Scientists are worried the tropical clawed frog, which has been identified in Hillsborough County, could have an impact on local wildlife. The amphibians are...
tropical clawed frogs
https://www.popsci.com/environment/article/2009-09/snake-clawed-foot-found-china/
Snake With Clawed Foot Found In China
Just because most mutants don't gain special powers doesn't make them any less interesting. Case and point, this snake discovered the other day in Southwest...
snakeclawedfootfoundchina
https://animaldiversity.org/accounts/Solisorex/classification/
Solisorex (Pearson's long-clawed shrew) | CLASSIFICATION | Animal Diversity Web
pearson s long clawed shrewsolisorexclassificationanimaldiversity
https://laughingsquid.com/a-group-of-asian-small-clawed-otters-playing-a-keyboard-at-the-smithsonians-national-zoo/
A Group of Asian Small-Clawed Otters Playing a Keyboard at the Smithsonian's National Zoo
Feb 22, 2017 - A group of Asian small-clawed otters play with a keyboard at the Smithsonian's National Zoo as part of an enrichment activity to keep them engaged and
asian small clawed otters
https://www.dailywire.com/news/ftx-bankruptcy-lawyers-reveal-how-much-they-have-clawed-back-for-defrauded-investors
FTX Bankruptcy Lawyers Reveal How Much They Have Clawed Back For Defrauded Investors
Attorneys managing the bankruptcy of defunct cryptocurrency exchange FTX announced that they have recovered some $5 billion in assets to repay defrauded...
https://www.kirkusreviews.com/book-reviews/rita-mae-brown/santa-clawed/
SANTA CLAWED | Kirkus Reviews
The holiday spirit takes it on the chin when a series of murders blemish picture-perfect Crozet, Va.
santaclawedkirkusreviews
https://www.avclub.com/cats-is-clawed-open-on-this-had-oscar-buzz-a-podcast-a-1846099251
Cats is clawed open on This Had Oscar Buzz, a podcast about not-so-award-winning films
Cats is clawed open on This Had Oscar Buzz, a podcast about not-so-award-winning films
https://www.gov.uk/guidance/white-clawed-crayfish-advice-for-making-planning-decisions
White-clawed crayfish: advice for making planning decisions - GOV.UK
How to assess a planning application when there are white-clawed crayfish on or near a proposed development site.
white clawed crayfishadvicemakingplanningdecisions
https://www.wcpo.com/news/political/national/washington-post-30-federal-workers-accidentally-paid-despite-shutdown-before-money-is-clawed-back
Washington Post: 30 federal workers accidentally paid despite shutdown before money is clawed back
Jan 12, 2019 - About 30 furloughed federal employees were accidentally paid in an apparent glitch before the funds were recovered, The Washington Post reported Friday.
https://www.sinica.edu.tw/en/news_content/36/3760
Academia Sinica-Inspired from the African Clawed Frog! "Smart Peptidyl Liposomes" Is One Step...
https://www.deccanherald.com/sports/cricket/how-kuldeep-clawed-back-into-reckoning-2678992
How Kuldeep clawed back into reckoning
Kuldeep, has an ill-fitting reputation of being left out despite good performances. Take the second Test against Bangladesh in December last year for example....
kuldeepclawedbackreckoning
https://bandzone.cz/clawedforehead/album/59278-at-the-end-of-spring.html
Clawed Forehead - Album: At The End Of Spring | Bandzone.cz
rock-alternative / Brno
at the endclawedforeheadalbumspring
https://www.livescience.com/45739-stolen-dinosaur-fossils-recovered.html
Stolen Skull of Long-Clawed, Ostrichlike Dinosaur Recovered | Live Science
May 20, 2014 - Recovered after being stolen by poachers in the Gobi Desert, a fossilized skull and foot bones tell paleontologists more about a bizarre dinosaur named...
stolenskulllongclaweddinosaur
https://www.livescience.com/47417-weirdest-worm-identified.html
Weirdest Worm Ever? Clawed Creature Finds Its Family Tree | Live Science
Aug 18, 2014 - A bizarre ancient worm so strange that its name derives from the word 'hallucination' has finally found its place on the tree of life.
family treeweirdestwormeverclawed
https://www.usgs.gov/media/images/weight-african-clawed-frog
Weight of African Clawed Frog | U.S. Geological Survey
Invasive species present a growing threat to ecosystems worldwide, and the African clawed frog (Xenopus laevis) is no exception. First detected in the U.S. in...
african clawed frogu sweightgeologicalsurvey
https://theweek.com/speedreads/657840/stephen-colbert-calmly-eviscerates-pentagon-congress-over-clawedback-troop-bonuses
Stephen Colbert calmly eviscerates Pentagon, Congress over clawed-back troop bonuses | The Week
Oct 27, 2016 - The latest Speed Read,/speed-reads,,speed-reads, breaking news, comment, reviews and features from the experts at The Week