Sponsor of the Day:
Jerkmate
https://hdsunflower.com/copyright-trademark-and-the-law
Copyright, Trademark and the Law
Trademarks for the Sunflower logo design, lanyard design and associated Hidden Disabilities Sunflower marketing and design for the Hidden Disabilities...
copyright trademarklaw
https://www.gm.com/copyright-trademark?evar25=ch_legal
Copyright, Trademark & Notices Information | General Motors
General Motors Copyright, Trademark, and Notices information call be found here for the GM brand. Learn more about our detailed copyright and trademark here.
copyright trademarknotices informationgeneral motors
https://www.creativelive.com/classes/copyright-trademark-and-intellectual-property-photographers-rachel-rodgers
What Photographers Need To Know Abut Copyright, Trademark, and Intellectual Property Rights |...
Whether you photograph weddings, capture senior portraits, or shoot high-fashion images, understanding key concepts like intellectual property, copyright, and...
intellectual property rightscopyright trademarkphotographersneedknow
https://store.nolo.com/products/patent-copyright-and-trademark-pctm.html
Patent, Copyright & Trademark - Intellectual Property Desk Reference - Nolo
This definitive intellectual property desk reference, full of definitions and straightforward explanations, will help you decipher patent, copyright, and...
patent copyrightintellectual propertydesk referencetrademarknolo
https://www.calabrio.com/copyrights/
Copyright & Trademark Notice | Calabrio Official Website
Jun 26, 2025 - Explore Calabrio’s copyright and trademark policies. Learn how we protect our brand, software, and website content under U.S. and international laws.
copyright trademarknoticecalabrioofficial
https://bernsteinip.com/
Bernstein IP | A Copyright, Trademark and Internet Law Firm
bernstein ipcopyright trademarkinternet lawfirm
https://www.jostens.com/about/legal/copyright-and-trademark
Copyright & Trademark | Jostens
Jostens, Inc. and its affiliated companies respect the intellectual property of others.
copyright trademarkjostens
https://patentlawip.com/blog/beverly-hills-bar-association-event-dressing-up-ip-copyright-trademark-and-licensing-issues-in-the-fashion-industry/
Beverly Hills Bar Association Event: Dressing Up IP: Copyright, Trademark, and Licensing Issues in...
Sep 19, 2012 - Great event at the Beverly Hills Bar Association, the program is titled: “Dressing Up IP: Copyright, Trademark, and Licensing Issues in the Fashion Industry.”
beverly hills barassociation eventcopyright trademarklicensing issuesdressing
https://www.dmca.com/research/
Copyright, Trademark, IP, research services & database monitoring
Your #1 provider of internet research services
copyright trademarkip researchservices databasemonitoring
https://www.zacco.com/services/
Services - Patent | Design | Copyright | Trademark | Cybersecurity
Feb 16, 2026 - Zacco provides intellectual property protection services including patent prosecution, design protection, copyright and trademark filing and cybersecurity
copyright trademarkservicespatentdesigncybersecurity
https://www.escrow.com/escrow-101/copyright-and-trademark-information
Copyright & Trademark Information - Escrow.com
Escrow.com retains full copyright ownership, rights and protection in all material on this site.
copyright trademarkinformationescrow
https://www.blm.gov/info/notices/drctp-policy
Digital Rights, Copyright, Trademark, Patent Policy | Bureau of Land Management
Digital Rights, Copyright, Trademark, Patent Policy The BLM fully complies with existing laws and directives that address the digital, copyright, trademark and...
digital rightscopyright trademarkpatent policyland managementbureau
https://www.dmca.com/research/?r=mmsup
Copyright, Trademark, IP, research services & database monitoring
Your #1 provider of internet research services
copyright trademarkip researchservices databasemonitoring
https://corporatefinanceinstitute.com/about-cfi/copyright-trademark-notice/
Copyright & Trademark Notice
Aug 29, 2025 - Copyright Notice. Copyright © CFI Education Inc. All Rights Reserved.
copyright trademarknotice
https://www.amsc.com/copyright-trademark-patent-statement/
Copyright, Trademark & Patent Statement - AMSC
copyright trademarkpatentstatementamsc
https://www.beneschlaw.com/practice/litigation/copyright-trademark-litigation/
Copyright & Trademark Litigation | Benesch, Friedlander, Coplan & Aronoff LLP
Benesch litigates copyright and trademark disputes to protect clients' intellectual property.
benesch friedlander coplancopyright trademarkaronoff llplitigation
https://www.nolo.com/legal-encyclopedia/patent-copyright-trademark
Patent, Copyright & Trademark
patent copyrighttrademark
https://www.legalzoom.com/business/intellectual-property/?openChat=true
Intellectual Property Protection Online - Trademark and Copyright Registrations, Provisional Patent...
Protect your intellectual property with a trademark, copyright, or patent with LegalZoom. Register a trademark or copyright, or apply for a patent easily and...
intellectual propertyprotection onlinecopyright registrationsprovisional patenttrademark
https://netbsd.org/about/disclaimer.html
Disclaimers, Trademark and Copyright Information
copyright informationdisclaimerstrademark
https://transparency.automattic.com/tumblr/copyright-and-trademark/
Copyright and Trademark | Transparency Report
At Tumblr, we dedicate a significant amount of time and resources to addressing issues involving intellectual property on our platform, such as processing DMCA...
transparency reportcopyrighttrademark
https://www.ibm.com/legal/copyright-trademark
IBM Copyright and Trademark Information
Listing of United States trademarks owned by IBM and related information.
trademark informationibmcopyright
https://www.texaslottery.com/export/sites/lottery/Misc/copyright.html
Texas Lottery | Copyright and Trademark Notice
Copyright and Trademark Notice
texas lotterytrademark noticecopyright
https://www.plagiarismtoday.com/2024/11/04/nasa-copyright-and-trademark-in-space/
NASA: Copyright and Trademark in Space - Plagiarism Today
Nov 4, 2024 - While it’s well known that NASA images and videos are public domain, there are still some restrictions to be aware of before using them.
plagiarism todaynasacopyrighttrademarkspace
https://www.uspto.gov/about-us/events/beyond-registration-taking-your-copyright-and-trademark-rights-next-level
Beyond registration: Taking your copyright and trademark rights to the next level | USPTO
trademark rightsnext levelbeyondregistrationtaking
https://www.law.com/newyorklawjournal/2026/02/18/erise-adds-trademark-and-copyright-attorneys-cheryl-burbach-blair-barbieri-lauren-byrne-and-kenzie-lawrence/?slreturn=20260409134651
Erise Adds Trademark and Copyright Attorneys Cheryl Burbach, Blair Barbieri, Lauren Byrne, and...
Erise IP has significantly expanded its nationally recognized trademark and copyright practice.
addstrademarkcopyrightattorneyscheryl
https://iccwbo.org/business-solutions/incoterms-rules/incoterms-rules-trademark-and-copyright-policy/
Incoterms® rules trademark and copyright policy - ICC - International Chamber of Commerce
Jan 8, 2025 - Incoterms® is a trademark used to brand the Rules devised by ICC and is copyright protected. Incoterms® 2020 logo is protected by both copyright and trademark...
icc international chambercopyright policyrulestrademarkcommerce
https://www.salesforce.com/company/legal/tmcusageguidelines/?bc=OTH
Trademark & Copyright Usage Guidelines | Salesforce
Some of Salesforce’s most valuable assets are its intellectual property. These include patents, trademarks, and copyrights.
trademark copyrightusage guidelinessalesforce
https://natlawreview.com/practice-groups/IP-Patent-Trademark-Copyright
Intellectual Property, Patent, Trademark, and Copyright Law | Nat
Latest intellectual property legal news: patent law, copyright law, trademarks, trade secrets, IP Litigation, cloud computing, artificial intelligence, drug...
intellectual property patentcopyright lawtrademarknat
https://www.heavengames.com/copyright/
Copyright and Trademark Notice – HeavenGames
trademark noticecopyrightheavengames
https://themeim.com/rulify-patent-copyright-trademark-law-firm-wordpress-theme/
Rulify-Patent, Copyright and Trademark Law Firm
Mar 16, 2026 - Trademark Company WordPress Theme build with clean code and modern WordPress framework, Bootstrap Lawfirm Theme. It’s suitable for any patent, certification,...
patent copyrighttrademark lawfirm
https://www.asu.edu/about/copyright-trademark
Copyright and Trademark | Arizona State University
arizona state universitycopyrighttrademark
https://www.uspto.gov/about-us/events/top-trademark-and-copyright-cases-china-what-rights-holders-need-know
Top trademark and copyright cases in China: What rights holders need to know | USPTO
top trademarkcopyright casesrights holdersknow usptochina
https://www.likelihoodofconfusion.com/legal-publications-ron-coleman/trademark-copyright-and-the-internet-time-to-return-balance-to-civil-litigation/
Trademark, Copyright, and the Internet: Time to Return Balance to Civil Litigation | LIKELIHOOD OF...
Nov 21, 2019 - Published in the August 31, 2010 edition of the Federalist Society’s Engage magazine. Excerpt: The law and business of intellectual property are in upheaval...
trademark copyrightinternet timecivil litigationreturnbalance
https://www.legalzoom.com/articles/trademarks-vs-copyrights-which-one-is-right-for-you
Trademark vs. Copyright: Which One Is Right for You?
Jan 6, 2026 - While copyrights and trademarks both provide legal protection, they have distinct purposes. Learn more about the differences between the two.
trademark vs copyrightone
https://hostzyro.com/
Host Zyro - Trademark, Copyright, Design, Import Export, Company Registration | ISO Certification |...
trademark copyrightimport exportcompany registrationiso certificationhost
https://sonyinteractive.com/en/copyright-and-trademark-notice/
Copyright and Trademark notice - Sony Interactive Entertainment
Jan 14, 2026 - “”, “PlayStation”, “PS5”, “PS4”, “PS3”, “PS2”, “DualSense”, “DUALSHOCK”, “Access”, “PlayStation Portal”, “PULSE Explore”, “PULSE Elite”, “PlayStation Link”,...
trademark noticesony interactivecopyrightentertainment
https://www.legalzoom.com/business/intellectual-property/
Intellectual Property Protection Online - Trademark and Copyright Registrations, Provisional Patent...
Protect your intellectual property with a trademark, copyright, or patent with LegalZoom. Register a trademark or copyright, or apply for a patent easily and...
intellectual propertyprotection onlinecopyright registrationsprovisional patenttrademark
https://report.mozilla.com/infringement-form
Mozilla Copyright or Trademark Infringement form
trademark infringementmozillacopyrightform
https://www.hostinger.com/legal/trademark-copyright-infringement
Trademark/copyright
Please read this agreement carefully, as it contains important information regarding your legal rights and remedies.
trademark copyright
https://www.copyrighted.com/blog/trademark-vs-copyright
Trademark vs Copyright: A Clear Look at Key Differences
Feb 26, 2026 - Explore the key differences between trademark and copyright in intellectual property to protect your brand and creative works better and effectively.
trademark vs copyrightclear lookkey differences
https://hodgsonlegal.com/
Hodgson Legal - Trademark - Music Copyright Law - Entertainment Hodgson Legal
legal trademarkmusic copyrighthodgsonlawentertainment
https://www.oberlo.com/blog/trademark-vs-copyright
Trademark vs. Copyright: Which Is Right for Your Business?
Do you need a trademark or a copyright? Learn the differences between the two and make the right choice for your business.
trademark vs copyrightbusiness
https://hostzyro.com/contact-us/
Contact Us - Host Zyro - Trademark, Copyright, Design, Import Export, Company Registration | ISO...
Nov 20, 2022 - We’d Love To Hear From You. Whether you have a question about our products/services, want to enhance your business or looking for something else?Our team is...
us hosttrademark copyrightimport exportcompany registrationzyro
https://maramiya.com/
Maramiya IP – Register Trademark | Patent | Copyright in Qatar | GCC & Middle East
trademark patentmiddle eastipregistercopyright
https://www.lenovo.com/us/en/legal/copytrade/
Copyright and Trademark Information | Lenovo US | Lenovo US
information lenovo uscopyrighttrademark
https://b2bconsulty.com/trademark-copyright-registration/
Secure Your Brand | Trademark & Copyright Services in Dubai
Jan 21, 2026 - If you need any trademark or copyright services in Dubai or UAE, B2B Consulty is available to help you with all of them at reasonable prices.
trademark copyrightsecurebrandservicesdubai
https://company360.in/
COMPANY360 Indias #1 portal for Trademark, Copyright, Patent
Jan 8, 2026 - Experts in Trademark, Copyright, Number 1 in Trademark Objection Reply and securing your brand with Agreements and contracts. Easy, Fast and Secure at...
1 portaltrademark copyrightindiaspatent
https://calendly.com/legal/dmca
Digital Millennium Copyright Act (DMCA) and Trademark Infringement Policy | Calendly
Digital Millennium Copyright Act (DMCA) and Trademark Infringement Policy
digital millennium copyrightact dmcatrademark infringementpolicycalendly
https://newsroom.gendigital.com/digital-asset-gallery-license-agreement
Trademark and Copyright License Agreement | Gen Digital
copyright licensegen digitaltrademarkagreement
https://www.nolo.com/legal-encyclopedia/which-protection-do-i-need-patent-copyright-or-trademark.html
Which Protection Do I Need: Patent, Copyright, or Trademark?
May 7, 2018 - Which form of intellectual property protection is right for you?
patent copyrightprotectionneedtrademark
https://norrismclaughlin.com/services/trademark-copyright-protection-enforcement/
Trademark & Copyright Protection & Enforcement - Norris McLaughlin, P.A., Attorneys at Law
Jan 17, 2023 - Trademarks and copyrights are critically important to protecting an organization’s identity, reputation, and market position. Norris McLaughlin’s trademark...
norris mclaughlin ptrademark copyrightprotection enforcementattorneyslaw
https://www.uspto.gov/trademarks/basics/trademark-patent-copyright
Trademark, patent, or copyright | USPTO
Trademarks, patents, and copyrights are different types of intellectual property, learn the differences between them.
trademark patentcopyrightuspto
https://www.atlassian.com/legal/copyright-and-trademark-violations
Reporting Copyright and Trademark Violations | Atlassian
reporting copyrighttrademark violationsatlassian
https://porkbun.com/legal/agreement/copyright_and_trademark_disputes
porkbun.com | copyright and trademark disputes
copyright and trademark disputes
trademark disputesporkbuncopyright
https://www.h-brs.de/en/urheber-und-kennzeichenrecht
Copyright and trademark law | Hochschule Bonn-Rhein-Sieg (H-BRS)
In all publications within its website (domain: www.h-brs.de), Hochschule Bonn-Rhein-Sieg respects the copyrights of the texts, graphics, sound documents and...
hochschule bonn rheintrademark lawcopyrightsiegbrs
https://www.hrfmlaw.com/
intellectual property rights, both domestic and foreign, including patent, trademark, copyright,...
intellectual property rightspatent trademarkdomesticforeignincluding
https://www.accessdevelopment.com/trademark-and-copyright/
Trademark & Copyright - Access Development
Feb 26, 2026 - View Access Development’s trademark and copyright information, including brand usage guidelines and intellectual property rights.
trademark copyrightaccess development
https://www.apple.com.cn/legal/intellectual-property/guidelinesfor3rdparties.html
Legal - Copyright and Trademark Guidelines - Apple
legal copyrighttrademark guidelinesapple
https://www.foley.com/practice-areas/intellectual-property/trademark-copyright--advertising-counseling/
Trademark, Copyright & Advertising Counseling | Foley & Lardner LLP
foley lardner llptrademark copyrightadvertisingcounseling
https://www.bolddesk.com/copyright
Copyright and Trademark Information Official Details | BoldDesk
Mar 18, 2026 - Review copyright and trademark information for BoldDesk and Syncfusion including registered marks, usage guidelines, and ownership details for all assets.
trademark informationofficial detailscopyrightbolddesk