https://www.defensedaily.com/
May 6, 2020 - The leading daily publication for business leads and defense market intelligence in land, sea, air, and space initiatives.
defense daily
https://www.defensedaily.com/defense-watch-wedgetail-energetics-partnering-drone-news/uncategorized/
Oct 17, 2025 - Wedgetail Deployment. The deployment term of a Royal Australian Air Force (RAAF) E-7A Wedgetail to Poland last July to aid Ukraine has ended. The plane
defense watchdrone newswedgetailenergeticspartnering
https://www.defensedaily.com/shikha-ganguly-l3harris-technologies/force-multipliers/
Jul 19, 2024 - In this monthly column, Defense Daily highlights individuals from across the government, industry and academia whose efforts contribute daily to national
defense dailyshikhagangulytechnologies
https://www.defensedaily.com/jags-kandasamy-latent-ai/force-multipliers/
Nov 17, 2025 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
ai defensejagskandasamylatentdaily
https://3quarksdaily.com/3quarksdaily/2025/11/platos-defense-of-the-humanities.html
Nov 23, 2025 - by Scott SamuelsonI was a freshman in college when I first read Plato’s Apology, his version of the event that probably made the biggest mark on him: his
defensehumanitiesquarksdaily
https://www.inverse.com/innovation/inverse-daily-may-10-2021
For the last decade or so, researchers, space agencies, and other governmental organizations have periodically come together to do a macabre dress rehearsal of...
best defenseinversedailyasteroid
https://www.dermstore.com/p/skinceuticals-daily-brightening-uv-defense-sunscreen-spf30-1-fl.-oz/13036144/?rctxt=default
A lightweight, residue-free sunscreen that combines broad-spectrum UV protection with a potent blend of discoloration-correcting and hydrating ingredients for...
uv defensefl ozskinceuticalsdailybrightening
https://www.defensedaily.com/force-multipliers-fred-taylor/force-multipliers/
Jul 28, 2025 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
force multipliersfred taylordefense daily
https://www.defensedaily.com/defense-watch-golden-dome-new-chinese-carrier-aukus-news-deloitte-invests/uncategorized/
Nov 9, 2025 - Golden Dome Advocacy. Michael Payne, the nominee to be director of DoD's office of Cost Assessment and Program Evaluation (CAPE), told senators in advance
defense watchgolden domenew chinesecarrieraukus
https://www.netapp.com/video/jsku-x-ofks/cyberattacks-the-daily-defense/
Unpack the anatomy of cyberattacks in this episode of The Daily Defense. Explore a real-world case and see how NetApp secure-by-design storage solutions...
cyberattacksdailydefensenetappvideo
https://sportsnaut.com/uncategorized/devils-daily-comments-on-hamiltons-defense-kane-watch-coming-to-a-close
In today's Devils Daily, Dougie Hamilton's struggles defensively continue, should New Jersey buy or sellf? Plus lots more.
devilsdailycommentshamiltondefense
https://www.the-express.com/news/world-news/196272/greenland-nato-troops-deploy-denmark-plea
Jan 16, 2026 - As European troops land in Greenland, tensions rise over Trump's bold Arctic ambitions. The island's future hangs in the balance amidst international intrigue.
nato troopsdanishpleagreenlanddefense
https://dailycaller.com/2025/06/30/anthropics-democrats-ai-artificial-intelligence-alarmism-trump-contracts/
Anthropic has publicly criticized the Trump administration's pro-innovation AI policies while quietly pursuing lucrative defense contracts.
defense contractsaicriticscompeting
https://www.defensedaily.com/tory-bruno-hops-from-ula-skips-to-blue-origin/space/
Dec 26, 2025 - Tory Bruno is to be the new head of the national security division of Blue Origin, owned by Amazon billionaire Jeff Bezos and a top competitor to SpaceX
tory brunoblue originhopsulaskips
https://www.crosswalk.com/devotionals/daily-hope-with-rick-warren/daily-hope-with-rick-warren-march-22-2019.html
Read Surrender Your Defense to God - Daily Hope with Rick Warren - March 22, 2019 from today's daily devotional. Be encouraged and grow your faith with daily...
daily hoperick warrensurrenderdefensegod
https://www.defensedaily.com/chris-wilson-qlik/force-multipliers/
Mar 14, 2025 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
chris wilsondefense dailyqlik
https://www.defensedaily.com/caci-makes-play-to-bolster-space-capabilities-with-2-6-billion-bid-for-arka-group/space/
Dec 22, 2025 - CACI International on Monday said it has agreed to acquire ARKA Group for $2.6 billion in cash, a deal that would make it a major player in high-end
space capabilitiescacimakesplaybolster
https://www.defensedaily.com/force-multipliers-adam-maruyama/force-multipliers/
Apr 18, 2025 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
force multipliersdefense dailyadammaruyama
https://www.defensedaily.com/defense-watch-boeing-machinists-big-gd-award-new-usv/uncategorized/
Oct 24, 2025 - Boeing Union to Vote. The union representing about 3,200 Boeing defense employees in the St. Louis region has authorized its members to vote on Oct. 26 on
defense watchboeingmachinistsbiggd
https://www.defensedaily.com/tim-solms-slingshot-aerospace/force-multipliers/
Jan 24, 2025 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
slingshot aerospacedefense dailytimsolms
https://www.defensedaily.com/guam-defense-still-connecting-dots-in-order-of-systems-official-says/army/
Nov 12, 2025 - An Army official Monday said that while the Guam Defense System (GDS) is progressing and the strategy aligns with Defense Secretary Pete Hegseth’s recent
guam defenseconnecting dotsstillordersystems
https://www.armyrecognition.com/archives/archives-defense-exhibitions/2026-archives-news-defense-exhibitions/dimdex-2026
Latest DIMDEX 2026 naval defense news from Qatar, covering warships, missiles, maritime surveillance systems and major industry updates.
naval defenseshow dailynews
https://www.defensedaily.com/commentary/restarting-explosive-nuclear-testing-is-a-bad-idea/
Nov 17, 2025 - By John Fairlamb, Ph.D., Defense Opinion Writer. Restarting explosive nuclear weapons testing, or even for political reasons conducting tests that don’t...
nuclear testingbad ideadefense dailyrestartingexplosive
https://www.dailysabah.com/tags?query=DEFENSE%20MINISTRY
Search results on DEFENSE MINISTRY, including latest news, updates, photos, top stories and more at DailySabah.com
defense ministrysearch resultsdaily sabah
https://www.defensedaily.com/jim-coyle-lookout/force-multipliers/
Jun 21, 2024 - In this monthly column, Defense Daily highlights individuals from across the government, industry and academia whose efforts contribute daily to national
defense dailyjimcoylelookout
https://www.mic.com/articles/157097/the-daily-show-calls-bs-on-melania-trump-s-defense-of-donald-trump
The Daily Show saw those Melania Trump interviews with Anderson Cooper and Fox News, but like many others, Trevor Noah and his team aren't buying it. And by...
daily showmelania trumpcallsbsdefense
https://www.neutrogena.com/products/neutrogena-purescreen-invisible-daily-defense-mineral-face-liquid-with-spf-30/6806407
Shield skin from harmful UVA/UVB rays and environmental aggressors. Try Neutrogena's 100% mineral sunscreen with liquid face sunscreen with SPF 30.
invisibledailydefensemineralface
https://www.defensedaily.com/will-smith-reli-group/force-multipliers/
May 20, 2024 - Defense Daily's monthly column highlighting individuals in government, industry and academia whose efforts contribute daily to national defense.
defense dailysmithreligroup
https://www.defensedaily.com/cbp-awards-new-surveillance-tower-contracts-to-atsc-gd-elbit/homeland-security/
Sep 8, 2023 - Customs and Border Protection has awarded contracts to three companies to provide new and upgraded surveillance towers to enhance border security,
awards newsurveillance towercbpcontractsatsc
https://www.defensedaily.com/cisa-issues-guidelines-to-lower-risks-of-drone-threats-to-critical-infrastructure/unmanned-systems/
Nov 19, 2025 - The Cybersecurity and Infrastructure Security Agency (CISA) has released a package of guidelines to assist owners and operators of critical infrastructure
cisaissuesguidelineslowerrisks