Robuta

https://determinant-calculator.com/ Determinant Calculator - Free Matrix Calculator Online Professional determinant calculator with step-by-step solutions for matrix calculations. Compute determinants for 2x2, 3x3, 4x4 and larger matrices instantly. determinant calculatorfreematrixonline https://pubmed.ncbi.nlm.nih.gov/40360795/ Metabolome-wide association identifies ferredoxin-1 (FDX1) as a determinant of cholesterol... The burden of cardiovascular disease is rising in the Asia-Pacific region, in contrast to falling cardiovascular disease mortality rates in Europe and North... https://www.southampton.ac.uk/research/projects/factor-inhibiting-hif-fih-in-lung-fibroblasts-a-determinant-of-aberrant Factor Inhibiting HIF (FIH) in lung fibroblasts: a determinant of aberrant mesenchymal-epithelial... Factor Inhibiting HIF (FIH) in lung fibroblasts: a determinant of aberrant mesenchymal-epithelial crosstalk?. https://epub.ub.uni-muenchen.de/121340/ Determinant Factors of Children's Blood Lead Levels in Java, Indonesia determinantfactorschildren https://arxiv.org/abs/1704.02344 [1704.02344] The Determinant and Volume of 2-Bridge Links and Alternating 3-Braids Abstract page for arXiv paper 1704.02344: The Determinant and Volume of 2-Bridge Links and Alternating 3-Braids https://publications-cnrc.canada.ca/eng/view/object/?id=b7948681-8b3f-493a-a282-64dce971c342 Studies towards neoglycoconjugates from the monosaccharide determinant of Vibrio cholerae O:1,... Studies towards neoglycoconjugates from the monosaccharide determinant of Vibrio cholerae O:1, serotype Ogawa using the diethyl squarate reagent from the https://researchconnect.buffalo.edu/en/publications/evolution-of-an-idiotypic-determinant-anti-val/ Evolution of an idiotypic determinant: Anti-val* - SUNY University at Buffalo evolutiondeterminant https://www.mdpi.com/2076-2615/13/23/3689 Predation Risk, and Not Shelter or Food Availability, as the Main Determinant of Reproduction... Reproductive investment, including the number of offspring produced, is one of the fundamental characteristics of a species. It is particularly important for... https://apps.microsoft.com/detail/9nblggh4tkvz?hl=en-US&gl=US Determinant-10-Matic - Free download and install on Windows | Microsoft Store Compute the determinant of any matrix with the Laplace's extension. download and installdeterminantmaticfree https://data.mendeley.com/datasets/3jy68skzrv/1 Data for: Structural and Operational Factors as Determinant of Meaningful Community Participation... Primary data collected through 230 sampled survey. https://ucrisportal.univie.ac.at/de/publications/does-interest-really-matter-interest-in-nature-as-a-possible-dete/ Does Interest Really Matter? Interest in Nature as a Possible Determinant of Pro-Environmental... https://news.med.virginia.edu/research/mariano-garcia-blanco-md-phd-and-team-discover-key-determinant-of-risk-for-multiple-sclerosis/ Mariano Garcia-Blanco, MD, PhD, and Team Discover Key Determinant of Risk for Multiple Sclerosis -... Jan 23, 2026 - University of Virginia School of Medicine scientists have discovered a key determinant of our risk for multiple sclerosis, advancing efforts to prevent and... https://scholars.duke.edu/publication/1702896 Scholars@Duke publication: VSIG10L is a major determinant of esophageal homeostasis and inherited... https://pubmed.ncbi.nlm.nih.gov/22689967/ Conserved genetic determinant of motor organ identity in Medicago truncatula and related legumes Plants exhibit various kinds of movements that have fascinated scientists and the public for centuries. Physiological studies in plants with the so-called... https://scholarshare.temple.edu/entities/publication/174a1ce3-3678-4bd8-99dd-b5183a8ccde7 Time and Times: The Times in Which We Live As A Social Determinant of Health Where someone lives, how much education they have, their income, all are recognized as social determinants of health, and as being of greater importance in... https://vtechworks.lib.vt.edu/items/1abfad01-9a1c-4141-a44f-ae5305758507 Health beliefs as a key determinant of intent to use anabolic-androgenic steroids (AAS) among... The use of anabolic-androgenic steroids (AAS) is problematic for youth because of negative effects such as reduced fertility, increased aggression and exposure... https://de.mathworks.com/matlabcentral/cody/problems/43026 Determinant of a 3x3 Matrix - MATLAB Cody - MATLAB Central of adeterminantmatrixmatlabcody https://ar5iv.labs.arxiv.org/html/1603.06705 [1603.06705] Determinant Formula for Parabolic Verma Modules of Lie Superalgebras We prove a determinant formula for a parabolic Verma module of a Lie superalgebra, previously conjectured by the second author. Our determinant formula... determinantformula https://www.mdpi.com/2413-8851/9/5/172 Time Wealth as a Determinant of Public Transport Behavior: Empirical Evidence from Japan In low-demand areas, optimizing public transport operations requires strategies that go beyond infrastructure improvements. Among the various influencing... https://research.vu.nl/en/activities/cultural-diversity-as-a-determinant-of-literary-education/ Cultural diversity as a determinant of literary education - Vrije Universiteit Amsterdam cultural diversityvrije universiteitdeterminant https://pubmed.ncbi.nlm.nih.gov/41018289/ Cardiorespiratory Fitness as a Determinant of Arterial Elasticity in Response to Exercise: Evidence... These findings underscore the importance of CRF in maintaining arterial elasticity and highlight differences in vascular adaptation to exercise between... https://www.kellogg.northwestern.edu/academics-research/research/detail/1995/on-the-determinant-of-economic-growth/ On the Determinant of Economic Growth | Kellogg School of Management on theeconomic growthdeterminantkelloggschool https://about.uq.edu.au/experts/project/33832 Nitrogen recycling as determinant for feed efficiency of Bos indicus cattle | Project | UQ Experts https://dorie.ec.europa.eu/en/details/-/card/234587 (EU) UE/ASILE : LA CONVENTION DETERMINANT L'ETAT RESPONSABLE DE L'EXAMEN DES DEMANDES D'ASILE EST... https://systemsbiology.ucsd.edu/index.php/publications/2025/rare-metabolic-gene-essentiality-determinant-microniche-adaptation-eschherichia Rare metabolic gene essentiality is a determinant of microniche adaptation in Eschherichia coli |... https://pmc.ncbi.nlm.nih.gov/articles/PMC33272/ Y chromosome polymorphism is a strong determinant of male fitness in Drosophila melanogaster - PMC In many species, the Y (or W) chromosome carries relatively few functional genes. This observation motivates the null hypothesis that the Y will be a minor... https://infoscience.epfl.ch/entities/publication/2925c9e1-96ba-493d-b30a-2715ee317813/statistics Notch signaling is a direct determinant of keratinocyte growth arrest and entry into differentiation The role of Notch signaling in growth/differentiation control of mammalian epithelial cells is still poorly defined. We show that keratinocyte-specific... https://research.birmingham.ac.uk/en/publications/the-transcriptional-factor-lbp-1ccp2lsf-gene-on-chromosome-12-is-/ The transcriptional factor LBP-1c/CP2/LSF gene on chromosome 12 is a genetic determinant of... https://collaborate.princeton.edu/en/publications/ploidy-is-an-important-determinant-of-fluoroquinolone-persister-s/ Ploidy is an important determinant of fluoroquinolone persister survival - Princeton University importantdeterminant https://www.repository.cam.ac.uk/items/6f4e8aa1-80c2-4a98-a50d-f4af3a585543 Characterization of a novel virulence determinant in Erwinia carotovora subspecies atroseptica... This study focused on the characterization of the gene rsmS in Erwinia carotovora subsp. atroseptica (Eca). Eca is a phytopathogenic Gram-negative bacteria,... of acharacterizationnovelvirulence https://kuscholarworks.ku.edu/entities/publication/8eab45b1-a6c4-41e9-8489-c20cf859a945 The determinant of the iterated Malliavin matrix and the density of a pair of multiple integrals The aim of this paper is to show an estimate for the determinant of the covariance of a two-dimensional vector of multiple stochastic integrals of the same... https://www.answers.com/american-government/Why_is_the_electoral_college_the_determinant_for_the_election_of_a_US_president Why is the electoral college the determinant for the election of a US president? - Answers The Electoral College was created as a compromise between slave states and free states. Slave states were worried that the more populous northern states would... the electoral college https://yalmip.github.io/reference/vandenberghe1998/ Determinant Maximization with Linear Matrix Inequality Constraints - YALMIP linear matrix inequalitydeterminantconstraints https://pure.psu.edu/en/publications/identification-of-transmembrane-domain-5-as-a-critical-molecular-/ Identification of transmembrane domain 5 as a critical molecular determinant of menthol sensitivity... as a https://pmc.ncbi.nlm.nih.gov/articles/PMC10482806/ Interpreting Microaggression as a Determinant of Wellbeing - PMC Despite the increasing interest in exploring microaggression in the humanitarian context, there remains uncertainty on its mechanism for affecting life... as ainterpretingmicroaggressiondeterminantwellbeing https://wbc.poznan.pl/dlibra/publication/62476/edition/78276/content?ref=L3B1YmxpY2F0aW9uLzM3MTEvZWRpdGlvbi82NTgz Practicing competitive sports at an earlier age as an important determinant of women's... Wielkopolska Digital Library is... Here put the description for the main page matadata, visible e.g. when sharing on Facebook. https://scholars.lib.ntu.edu.tw/entities/project/9a159a38-1ec3-47d2-b98c-c1987de1e5bb Surface Protein Acetylation on the Recurrent Flagellum Is a Virulent Determinant for the Human... https://www.mdpi.com/2071-1050/12/20/8647 Determinant Factors of Pedestrian Volume in Different Land-Use Zones: Combining Space Syntax... This study combined space syntax metrics and geographic information systems (GIS)-based built-environment measures to analyze pedestrian volume in different... https://docs.unity3d.com/2019.2/Documentation/ScriptReference/Matrix4x4-determinant.html Unity - Scripting API: Matrix4x4.determinant scripting apiunitydeterminant https://documents.worldbank.org/en/publication/documents-reports/documentdetail/200741468331267691 Is the level of financial sector development a key determinant of private investment in the power... This paper seeks to assess the extent to which a country's overall level of development and that of its financial sector, in particular, are factors that... https://bazekon.uek.krakow.pl/en/rekord/171440148 BazEkon - Wolny Ada. Accessibility of Real Estate by Transportation as a Determinant of the... of real estate https://ocw.mit.edu/courses/18-06sc-linear-algebra-fall-2011/pages/least-squares-determinants-and-eigenvalues/determinant-formulas-and-cofactors/ Determinant Formulas and Cofactors | Linear Algebra | Mathematics | MIT OpenCourseWare This section provides a lesson on determinant formulas and cofactors. linear algebradeterminantformulascofactorsmathematics https://www.ncbi.nlm.nih.gov/protein/AAD22144.1 chloramphenicol resistance determinant (plasmid) [Klebsiella aerogenes - Protein - NCBI chloramphenicolresistancedeterminantplasmidklebsiella https://about.uq.edu.au/experts/project/65425 The role of First Nations' music as a determinant of health (ARC Discovery Indigenous grant led by... https://it.mathworks.com/help/matlab/ref/det.html det - Matrix determinant - MATLAB This MATLAB function returns the determinant of square matrix A. detmatrixmatlab https://pubmed.ncbi.nlm.nih.gov/18499264/ The correlation determinant in tests for synchronization in neuronal spike data We present a statistical approach to the identification of correlated activity in multineuron spike data, based on the value of the correlation determinant.... correlationdeterminanttestssynchronizationneuronal https://necat.chem.cornell.edu/identification-major-determinant-serine-threonine-kinase-phosphoacceptor-specificity Identification of a major determinant for serine-threonine kinase phosphoacceptor specificity. |... of aidentificationmajordeterminant https://pubmed.ncbi.nlm.nih.gov/24050169/ Multiple hormonal dysregulation as determinant of low physical performance and mobility in older... Mobility-disability is a common condition in older individuals. Many factors, including the age-related hormonal dysregulation, may concur to the development... https://amaral.northwestern.edu/publications/dynamics-and-heterogeneity-fate-determinant-during-transition-towards-cell-differentiation/ Dynamics and heterogeneity of a fate determinant during transition towards cell differentiation -... of a https://research-portal.uu.nl/en/publications/spike-gene-variability-in-porcine-epidemic-diarrhea-virus-as-a-de/ Spike gene variability in porcine epidemic diarrhea virus as a determinant for virulence - Utrecht... https://ximera.osu.edu/la/LinearAlgebra/DET-M-0040/main DET-0040: Properties of the Determinant - Ximera Ximera provides the backend technology for online courses of thedetpropertiesximera https://it.mathworks.com/matlabcentral/cody/problems/59506-compute-the-determinant-of-a-divisibility-matrix Compute the determinant of a divisibility matrix - MATLAB Cody - MATLAB Central of acomputedeterminantdivisibilitymatrix https://documents.worldbank.org/en/publication/documents-reports/documentdetail/569001468739504566 Labor market performance as a determinant of migration In a comparison of migrants with nonmigrants, both observed and unobservable productivity factors are relevant. This paper focuses more on the unobservable... labor marketperformancedeterminantmigration https://ocw.mit.edu/courses/18-03sc-differential-equations-fall-2011/resources/trace-determinant-diagram/ Trace-Determinant Diagram | Differential Equations | Mathematics | MIT OpenCourseWare MIT OpenCourseWare is a web based publication of virtually all MIT course content. OCW is open and available to the world and is a permanent MIT activity differential equationstracedeterminantdiagrammathematics https://www.wikidata.org/wiki/Q39837509 The cell attachment determinant in fibronectin - Wikidata the cellattachmentdeterminantfibronectinwikidata https://pubmed.ncbi.nlm.nih.gov/37465173/ Gender as a determinant of physical activity levels and mental health of medical students from... The findings of the study did not reveal strong correlations between kinesiophobia and PA levels in students from Poland and Belarus in the context of... https://pmc.ncbi.nlm.nih.gov/articles/PMC19490/ Ribonucleotide reductase R2 component is a novel malignancy determinant that cooperates with... Ribonucleotide reductase is a highly regulated cell cycle-controlled activity that is essential for DNA synthesis and repair. A retroviral vector for the R2... ribonucleotide reductase https://pmc.ncbi.nlm.nih.gov/articles/PMC10498908/ Racism as a determinant of health and health care: Rapid evidence narrative from the SAFE for... https://www.start.umd.edu/publication/killing-messenger-regime-type-determinant-journalist-killing-1992-2008 Killing the Messenger: Regime Type as a Determinant of Journalist Killing, 1992-2008 | START.umd.edu What countries are most dangerous for journalists? Both conventional wisdom and extant literature on political violence, democracy, and reporter fatalities... https://pubmed.ncbi.nlm.nih.gov/12381810/ Molecular mechanism of a COOH-terminal gating determinant in the ROMK channel revealed by a... The ROMK subtypes of inward-rectifier K(+) channels mediate potassium secretion and regulate NaCl reabsorption in the kidney. Loss-of-function mutations in... https://pmc.ncbi.nlm.nih.gov/articles/PMC8355515/ Magnitudes of Anemia and Its Determinant Factors Among Lactating Mothers in East African Countries:... Background: The number of studies on the magnitude of anemia and its determinant factors among lactating mothers is limited in East African countries... https://pmc.ncbi.nlm.nih.gov/articles/PMC4153075/ Lactase non-persistence as a determinant of milk avoidance and calcium intake in children and... This study examines if lactase non-persistent (LNP) children and adolescents differ from those who are lactase persistent (LP) as regards milk avoidance and Ca... https://arxiv.org/abs/2603.22265 [2603.22265] Cohesive Membranes under determinant constraints Abstract page for arXiv paper 2603.22265: Cohesive Membranes under determinant constraints cohesivemembranesdeterminantconstraints https://tagteam.harvard.edu/hub_feeds/4415/feed_items/7357691 TagTeam :: Funding as a determinant of Citation Impact in Scientific Papers in different countries... https://www.wikidata.org/wiki/Q34324039 Epstein-Barr virus nuclear protein 2 is a key determinant of lymphocyte transformation - Wikidata epstein barr virus https://community.oracle.com/customerconnect/discussion/591208/fusion-applications-task-manage-set-assignments-for-set-determinant-type-what-is-the-purpose Fusion Applications - Task - Manage Set Assignments for Set Determinant Type - What is the... Summary For a specific Reference Group Name what is the purpose of associating Determinant Value and Set Name ?Content fusion applications https://scholars.duke.edu/publication/744315 Scholars@Duke publication: A short segment of the HIV-1 gp120 V1/V2 region is a major determinant... https://nrc-publications.canada.ca/eng/view/object/?id=4283a323-966d-445a-98c9-e6a1bf39b255 Identification of the common antigenic determinant shared by Streptococcus pneumoniae serotypes 35A... Identification of the common antigenic determinant shared by Streptococcus pneumoniae serotypes 35A and 20 capsular polysaccharides: Structural analysis of the... of the https://researchconnect.buffalo.edu/en/publications/maternal-health-insurance-coverage-as-a-determinant-of-obstetrica/ Maternal health insurance coverage as a determinant of obstetrical anesthesia care - SUNY... health insurance coverage https://github.com/QMCPACK/qmcpack/pull/5111 Prevent SOECP exact spin evaluation with multi slater determinant wave functions due to incomplete... Main repository for QMCPACK, an open-source production level many-body ab initio Quantum Monte Carlo code for computing the electronic structure of atoms,... https://eric.ed.gov/?id=EJ1162160 ERIC - EJ1162160 - Offense Type as Determinant of Revenge and Forgiveness after Victimization:... Victims of injustice and aggression may have strong feelings about the perpetrator(s) that may impede their efforts to cope with the victimizing experience. We... https://mpra.ub.uni-muenchen.de/106870/ Determinant of Inflation in Pakistan: An Econometric Analysis, Using Johansen Co Integration... https://scholarshare.temple.edu/entities/publication/2cb2f085-09b4-46b7-b0f9-1303b35a9a96 A molecular determinant of phosphoinositide affinity in mammalian TRPV channels Phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2 ] is an important cofactor for ion channels. Affinity for this lipid is a major determinant of channel... moleculardeterminantaffinitymammaliantrpv https://bazekon.uek.krakow.pl/rekord/171473426 BazEkon - Chan Shook Mei, Tih Siohong. Determinant Factors of Industrial Purchasing Personnel's... https://researchdiscovery.drexel.edu/esploro/outputs/doctoral/Germline-encoded-T-cell-receptor-sequences-are-a/991014970223604721 Germline-encoded T-cell receptor sequences are a determinant of diabetes susceptibility and... Our previous studies identified a T-cell receptor variable region, TCRV1313, as the genetic element underlying Iddm14, a strong quantitative trait locus (QTL)... https://arxiv.org/abs/2411.04527v1 [2411.04527v1] Efficiency of the hidden fermion determinant states Ansatz in the light of different... Abstract page for arXiv paper 2411.04527v1: Efficiency of the hidden fermion determinant states Ansatz in the light of different complexity measures https://hraf.yale.edu/ehc/hypotheses/491 Hypothesis for: The relevance of family cohesiveness as a determinant of premarital sexual behavior... Jan 5, 2015 - ". . . presence of a high lineal sense will be related to large differences between the values of a society [with regard to premarital sex and pregnancy] and... https://ub01.uni-tuebingen.de/xmlui/handle/10900/177365 GFR is a Key Determinant of Red Blood Cell Survival in Anemia Associated With Progressive CKD https://ifp.nyu.edu/2017/journal-article-abstracts/maternal-smoking-a-life-course-blood-pressure-determinant/ Maternal smoking: a life course blood pressure determinant? - information for practice a lifeblood pressureinformation formaternalsmoking https://kr.mathworks.com/matlabcentral/answers/349847-fiedler-matrix-determinant-behaviour?s_tid=prof_contriblnk Fiedler matrix determinant behaviour - MATLAB Answers - MATLAB Central Fiedler matrix determinant behaviour. Learn more about fiedler, matrix, determinant fiedlermatrixdeterminantbehaviourmatlab https://www.mathworks.com/help/aeroblks/determinantof3x3matrix.html Determinant of 3x3 Matrix - Compute determinant of matrix - Simulink The Determinant of 3x3 Matrix block computes the determinant for the input matrix. determinantmatrixcomputesimulink https://mpra.ub.uni-muenchen.de/122725/ Population age structure as a determinant of long-run macroeconomic growth: demographic endogenous... https://ifp.nyu.edu/2024/journal-article-abstracts/social_connectedness_as_a_determinant_of_health_in-4-aspx/ Social Connectedness as a Determinant of Health in African-American Low-Income Families with Young... May 16, 2024 - ABSTRACT: Objective: This cross-sectional study aimed to assess the level of social connectedness (SC) in African-American low-income families with young https://journals.plos.org/plosone/article/comments?id=10.1371/journal.pone.0231344 Cross-reactive carbohydrate determinant interference in cellulose-based IgE allergy tests utilizing... Background Cross-reactive carbohydrate determinant (CCD) structures found in plant and insect glycoproteins are commonly recognized by IgE antibodies as... https://pubmed.ncbi.nlm.nih.gov/32928959/ The Ig-like domain of Punctin/MADD-4 is the primary determinant for interaction with the ectodomain... Punctin/MADD-4, a member of the ADAMTSL extracellular matrix protein family, was identified as an anterograde synaptic organizer in the nematode... https://pmc.ncbi.nlm.nih.gov/articles/PMC23468/ Endoplasmic reticulum quality control of asialoglycoprotein receptor H2a involves a determinant for... The human asialoglycoprotein receptor H2a subunit contains a charged pentapeptide, EGHRG, in its ectodomain that is the only sequence absent from the H2b... endoplasmic reticulumquality control https://research.birmingham.ac.uk/en/publications/traffic-related-air-pollution-as-a-determinant-of-asthma-among-ta/ Traffic related air pollution as a determinant of asthma among Taiwanese school children -... https://pure.psu.edu/en/publications/scaffold-properties-are-a-key-determinant-of-the-size-and-shape-o/ Scaffold properties are a key determinant of the size and shape of self-assembled virus-derived... https://experts.arizona.edu/en/publications/asymptotics-of-recurrence-relation-coefficients-hankel-determinan/ Asymptotics of recurrence relation coefficients, hankel determinant ratios, and root products... asymptoticsrecurrencerelationcoefficients https://ideas.repec.org/p/pra/mprapa/26046.html Household income as a determinant of child labor and school enrollment in Brazil: Evidence from a... Downloadable! This paper studies the effects of household income on labor participation and school enrollment of children aged 10 to 14 in Brazil using a... https://arxiv.org/abs/2403.06722 [2403.06722] Asymptotics of the finite-temperature sine kernel determinant Abstract page for arXiv paper 2403.06722: Asymptotics of the finite-temperature sine kernel determinant of theasymptoticsfinitetemperaturesine https://docs.unity3d.com/2017.1/Documentation/ScriptReference/Matrix4x4-determinant.html Unity - Scripting API: Matrix4x4.determinant Unity is the ultimate game development platform. Use Unity to build high-quality 3D and 2D games, deploy them across mobile, desktop, VR/AR, consoles or the... scripting apiunitydeterminant https://www.bu.edu/sph/news/articles/2017/history-as-a-determinant-of-health/ History as a Determinant of Health | SPH as ahistorydeterminanthealthsph https://pmc.ncbi.nlm.nih.gov/articles/PMC8009412/ The burden of hyaline membrane disease, mortality and its determinant factors among preterm... Hyaline membrane disease (HMD) is a leading cause of morbidity and mortality in preterm newborn babies. Though, there are studies related to Hyaline membrane... https://zemanpeter.github.io/blog/2025/graham-pollak/ Graham-Pollak determinant formula | Peter Zeman A beautiful formula for the determinant of the distance matrix of a tree. grahampollakdeterminantformulapeter https://www.wikidata.org/wiki/Q41531902 Identification of a portable determinant of cell cycle function within the carboxyl-terminal domain... scientific article published on August 1, 1992 https://pmc.ncbi.nlm.nih.gov/articles/PMC23287/ A secreted Salmonella protein with homology to an avirulence determinant of plant pathogenic... Bacterial pathogens have evolved sophisticated mechanisms to interact with their hosts. A specialized type III protein secretion system capable of... https://pubmed.ncbi.nlm.nih.gov/23900309/ Glycosylation of tyrosinase is a determinant of melanin production in cultured melanoma cells The majority of malignant melanoma cell types are able to produce melanin and the degree of melanin synthesis in various types of cultured cell line differs.... is a https://www.wikidata.org/wiki/Q35286617 Nucleotide sequence of the repressor gene of the TN10 tetracycline resistance determinant. -... of thenucleotidesequencegenetetracycline https://publikationen.uni-tuebingen.de/xmlui/handle/10900/117996 Identification of RipAZ1 as an avirulence determinant of Ralstonia solanacearum in Solanum... ralstonia solanacearumidentification