https://www.upmc.com/media/news/100616-how-repair-protein-finds-dna-damage
Read a news release about Pitt Scientists Identifing How Repair Protein Finds DNA Damage at UPMC CancerCenter.
dna damagepittscientistsidentifyrepair
https://pubmed.ncbi.nlm.nih.gov/28345297/
In response to DNA damage, a cell can be forced to permanently exit the cell cycle and become senescent. Senescence provides an early barrier against tumor...
dna damageresidualactivitysenescence
https://www.scrippsnews.com/science-and-tech/smoking-can-cause-damage-to-your-dna-even-after-you-quit
According to a new study, smoking can cause changes to your DNA that can last for decades.
after yousmokingcausedamagedna
https://pubmed.ncbi.nlm.nih.gov/19818714/
Although the BBAP E3 ligase and its binding partner BAL are overexpressed in chemotherapy-resistant lymphomas, the role of these proteins in DNA damage...
bbaphistonelysine
https://www.antteknik.com/en/literatur/?a=pharmaceutical-life-science&li=analysis-of-dna-damage-size-with-lcmsms
ANT TEKNIK, representing leader companies including Shimadzu, Hitachi Koki, Applikon, Rudolph Research, Merck, Restek, Ecolab and more, offers know-how,...
dna damageanalysissizecom
https://pubmed.ncbi.nlm.nih.gov/26832404/
Cell-cycle checkpoints are essential feedback mechanisms that promote genome integrity. However, in the face of unrepairable DNA lesions, bypass mechanisms can...
dna damage checkpointcentrosomedependentbypass
https://pubmed.ncbi.nlm.nih.gov/41605654/
A tightly regulated DNA damage response is critical to the overall integrity of the genome. Here, we combine transcriptomics and proteomics to study DNA damage...
dna damage responsesystemsviewkineticstetrahymena
https://pubmed.ncbi.nlm.nih.gov/31142837/
Access to DNA packaged in nucleosomes is critical for gene regulation, DNA replication and DNA repair. In humans, the UV-damaged DNA-binding protein (UV-DDB)...
dna damagedetectionnucleosomesregistershifting
https://pubmed.ncbi.nlm.nih.gov/24990965/
The ATR (ATM [ataxia telangiectasia-mutated]- and Rad3-related) checkpoint is a crucial DNA damage signaling pathway. While the ATR pathway is known to...
dna damagesumoylationatripsignalingboosting
https://www.sigmaaldrich.com/PL/en/technical-documents/technical-article/research-and-disease-areas/cancer-research/dna-damage-and-repair
DNA damage and repair mechanism is vital for maintaining DNA integrity. Damage to cellular DNA is involved in mutagenesis, the development of cancer among...
dna damagerepair
https://www.technologynetworks.com/cancer-research/news/liver-cancer-model-points-to-dna-damage-repair-pathway-for-novel-therapies-376001
Research using the model hinted at potential pathways to improve therapies, including DNA damage repair pathways, well-known for their roles in other cancer...
dna damage repairliver cancermodelpointspathway
https://www.theepochtimes.com/epochtv/bipolar-in-the-genes-how-to-prevent-dna-damage-5932431
If bipolar disorder’s origin lies in nerve cells and genes, what can be done to prevent it taking hold?
in thehow todna damagebipolargenes
https://pubmed.ncbi.nlm.nih.gov/35880862/?dopt=Abstract
Xeroderma Pigmentosum group A-binding protein 2 (XAB2) is a multifunctional protein playing a critical role in distinct cellular processes including...
dna damagedynamicsdependenttranscriptioninhibition
https://pubmed.ncbi.nlm.nih.gov/26447830/
The ubiquitous epigenetic silencing of GSTP1 in prostate cancer results in enhanced survival and accumulation of potentially promutagenic DNA adducts following...
dna baselossresultsaccumulationoxidative
https://www.nist.gov/publications/nanosilver-suppresses-growth-and-induces-oxidative-damage-dna-caenorhabditis-elegans
The utility of C. elegans as an alternative model to assess nanomaterial toxicity was evaluated using 10 nm silver particles (10nmAg).
oxidative damagenanosilversuppressesgrowthinduces
https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2022.968927/full
E3 ubiquitin ligases, an important part of ubiquitin proteasome system, catalyze the covalent binding of ubiquitin to target substrates, which plays a role i...
ubiquitin ligasefrontiersregulatoryroles
https://www.ojp.gov/library/publications/assessing-effects-dna-damage-next-generation-mtdna-sequencing
This study assessed the impact of DNA damage on the interpretation of massively parallel sequencing mitochondrial (mt) DNA heteroplasmy from a variety of...
the effectsdna damagenext generationmtdna
https://www.nist.gov/publications/bisphenol-leads-oxidative-dna-damage-and-alters-damage-response-mouse-fibroblasts
Metabolism of bisphenol A (BPA) generates reactive oxygen species causing DNA strand breaks and damaged DNA bases.
oxidative dna damageleads tobisphenolalters