https://www.whatsthestorywishbone.com/
What's The Story, Wishbone? | A Feature Length Documentary
A heartfelt documentary exploring the beloved PBS series that introduced classic literature to an entire generation.
the storyfeature lengthwishbonedocumentary
https://getpodcast.com/pt/podcast/architecture-design-and-photography/109-harrison-buck-overcoming-adversity-to-create-a-feature-length-docu_fb5f99a4b6
#109 - Harrison Buck: Overcoming Adversity to Create a Feature-Length Documentary - Architecture,...
overcoming adversityfeature lengthharrisonbuckcreate
https://963theblaze.com/new-fly-fishing-feature-length-movie-filming-in-montana/
New Fly Fishing Feature Length Movie Filming in Montana
A new movie called Mending the Line is filming in southwest Montana.
fly fishingfeature lengthnewmoviefilming
https://www.themat.com/news/2016/may/02/minnesota-head-wrestling-coach-j-robinson-featured-in-an-upcoming-feature-length-documentary-film
Minnesota Head Wrestling Coach J Robinson featured in an upcoming feature length documentary film |...
featured indocumentary filmminnesotaheadwrestling
https://horror-fix.com/crew-members-for-a-live-action-feature-length-epic/
Crew members for a live-action feature-length epic - HorrorFix
Feb 23, 2023 - Horror Movie News, Horror Movie Reviews and Exclusive Horror Content
crew memberslive actionfeature lengthepic
https://soldiersystems.net/2024/07/07/mca-releases-its-first-video-series-and-feature-length-film-on-battle-of-first-manassas/
MCA Releases its First Video Series and Feature Length Film on Battle of First Manassas | Soldier...
Jul 7, 2024 - Quantico, VA, Jun 28, 2024: The Marine Corps Association released its first video series and feature length film on the Battle of First Manassas. The projec ...
first videofeature lengthfilm onmcareleases
https://www.kanpai-japan.com/japanese-anime-movies
Japanese Animated Movies - Feature-length Animations for Every Kind of Public
Even though the debuts of Japanese animation date back to thirty years earlier, the first artwork that can be considered a true Japanese animated movie is...
animated moviesfeature lengthkind ofjapaneseanimations
https://www.newmediafilmfestival.com/category/feature-length/
Feature Length Archives - New Media Film Festival
feature lengthnew mediafilm festivalarchives
https://store.grasshopperfilm.com/straub-huillet-feature-films.html?Session_ID=39c3b9593fdfc36b9b92d54c9662e4b5
Grasshopper Educational: Straub-Huillet | Feature-Length
feature lengthgrasshoppereducationalstraub
https://film-english.com/genre/feature-length-film/
Feature-length film Archives - Film English
feature lengthfilmarchivesenglish
https://www.animenewsnetwork.com/news/2020-05-17/studio-durian-plans-shishigari-feature-length-anime-film-project/.159630
Studio Durian Plans Shishigari Feature-Length Anime Film Project - News - Anime News Network
Studio produced "Shishigari" anime short that premiered at Fantasia Festival last year
studio durianfeature lengthanime filmproject newsplans
https://premium.boingboing.net/p/feature-length-fallout-fan-animation
Feature-length Fallout fan animation depicts a pivotal moment in series lore
War never changes, but it does occasionally shift into badass animated form.
feature lengthin seriesfalloutfananimation
https://nunatsiaq.com/stories/article/65674arnait_video_of_igloolik_premieres_feature-length_film_in_montreal/
Arnait Video of Igloolik premieres feature-length film in Montreal
Newspaper of record for Nunavut, and the Nunavik territory of Quebec
feature lengthvideopremieresfilmmontreal
https://telefilm.ca/en/telefilm-canada-selects-12-feature-length-films-in-the-english-market-under-the-production-program
Telefilm Canada selects 12 feature-length films in the English market under the Production Program...
Mar 17, 2025 - Telefilm Canada is announcing its commitment to 12 feature-length films in the English market under the Production Program (as part of the latest round of...
telefilm canadafeature lengththe englishselectsfilms
https://www.hauraki.co.nz/the-acc/the-agenda/feature-length-agenda-have-the-chiefs-climaxed-too-early/
Feature Length Agenda: "Have The Chiefs Climaxed Too Early?"
feature lengthtoo earlyagendachiefs
https://manifold.markets/ByrneHobart/will-an-ai-tool-be-able-to-generate
Will an AI tool be able to generate a feature-length movie about the OpenAI drama before the...
16% chance. Because the resolution criteria are somewhat subjective, I will not be trading in this market. Basically trying to answer this as a reasonable...
an ai toolbe ablefeature lengthgeneratemovie
https://anagora.org/that%20s%20sort%20of%20my%20point%20there%20s%20no%20technical%20reason%20why%20feature%20length%20film%20budgets%20should%20be
[[that s sort of my point there s no technical reason why feature length film budgets should be]]...
The Agora is a free knowledge commons: anagora.org.
sort offeature lengthpointtechnicalreason
https://dumbotaku.com/info/2921
Kenji Kamiyama Routes 'Eien no 831' Feature-Length Unique in January 2022 | Dumb Otaku
Mar 15, 2026 - WOWOW opened up a main site for a feature-length initial anime entitled Eien no 831 ( The Timeless 831) on Tuesday, arranged to premiere on the network in...
feature lengthin januarykenjikamiyamaroutes
https://www.abbozzogallery.com/art/5669060
Feature Length 3D 1/10 by Kelly Grace | Abbozzo Gallery
Feature Length 3D 1/10 by Kelly Grace
feature lengthabbozzo gallerykellygrace
https://barnetfc.com/feature-length-holmes-interview
FEATURE LENGTH HOLMES INTERVIEW - Barnet Football Club
As we announced a few days ago, Barnet Player is getting a revamp with XFM DJ and Bees fan Steve Harris joining the service as a regular contributor. Steve...
barnet football clubfeature lengthholmesinterview
https://www.mca-marines.org/newsroom/mca-releases-its-first-video-series-and-feature-length-film-on-battle-of-first-manassas/
MCA Releases its First Video Series and Feature length film on Battle of First Manassas - Marine...
Jul 1, 2025 - Quantico, VA, Jun 28, 2024: The Marine Corps Association released its first video series and feature length film on the Battle of First Manassas. The project,
first videofeature lengthfilm onmcareleases
https://www.gamesradar.com/entertainment/sci-fi-shows/alien-earth-episode-5-isnt-quite-feature-length-but-i-think-its-best-alien-movie-since-aliens/
Alien: Earth episode 5 isn't quite feature-length, but I think it's best Alien movie since Aliens |...
Sep 3, 2025 - Our writer argues that the latest episode of Alien: Earth is the best installment in the franchise since James Cameron's '80s sequel
alien earthfeature lengththink itepisodequite
https://www.surrey.ac.uk/news/phd-student-debut-feature-length-documentary-london-cinema-old
PhD student to debut feature-length documentary in London Cinema | University of Surrey
university of surreyphd studentfeature lengthin londondebut
https://www.beautyzonear.com/product/new-feature-length/1895
NEW! Feature Length | Beauty Zone
FEATURE LENGTH by Raquel Welch offers wave after wave of lush, soft layers that fall to mid-back. A timeless leading lady look that commands attention. Made...
new featurelengthbeautyzone
https://humanitystoked.com/
Humanity Stoked - Feature length documentary film about the love of humanity and skateboarding
feature lengthdocumentary filmthe lovehumanitystoked
https://socialcompare.com/en/review/finding-vivian-maier-a-feature-length-documentary-film-project-by-tonelo-q4d6ozn
"Finding Vivian Maier" - a feature length documentary film Project by Toneloof | Comparison tables...
vivian maierfeature lengthdocumentary filmcomparison tablesfinding
https://www.fi.freelancer.com/projects/screenwriting/feature-length-romantic-drama-screenplay
Feature-Length Romantic Drama Screenplay | Freelancer
feature lengthromantic dramascreenplayfreelancer
https://www.okayafrica.com/michaela-coel-set-to-star-in-upcoming-feature-length-musical-been-so-long/153210
Michaela Coel Set to Star In Upcoming Feature-Length Musical 'Been So Long' | OkayAfrica
Jun 8, 2023 - The 'Chewing Gum' showrunner is the lead in a new London-set musical 'Been So Long.'
michaela coelset tofeature lengthstarupcoming
https://www.wordhippo.com/what-is/another-word-for/feature_length_film.html
What is another word for "feature-length film"?
Synonyms for feature-length film include feature film, feature, full-length motion picture, main attraction, big picture, movie and film. Find more similar...
what isfeature lengthanotherwordfilm
https://www.coursera.org/learn/write-a-feature-length-screenplay-for-film-or-television
Write A Feature Length Screenplay For Film Or Television | Coursera
Offered by Michigan State University. Write a Full Length Feature Film Script In this course, you will write a complete, feature-length ... Enroll for free.
feature lengthwritescreenplayfilmtelevision
https://www.anagramtimes.com/2011/10/downton-abbey-to-battle-doctor-who-in.html
The Anagram Times: Downton Abbey to battle Doctor Who in feature-length Christmas special?
( Metro ) Photo: KCTS 9 (You must turn on Java in your web browser to see this Animated Anagrams applet.) Downton Abbey...
the anagram timesdownton abbeydoctor whofeature lengthchristmas special
https://www.engadget.com/2013-10-26-shooting-a-feature-length-movie-with-an-ipad-curtis-and-dave-are.html
Shooting a feature-length movie with an iPad: "Curtis & Dave Are Dead"
Oct 26, 2013 - John Gibson is a driven moviemaker who has made a feature length movie using a 3rd generation iPad as the camera. The movie deals with death and the...
feature lengthshootingmovieipadcurtis
https://japanswhores.com/movie/chinese-historical-feature-length-cag-with-naked-geishas/
Chinese historical feature-length cag with naked Geishas
feature lengthchinesehistoricalcagnaked
https://archive.louisville.com/content/feature-length-action-comedy-starts-production-louisville
Feature Length Action Comedy Starts Production in Louisville | Louisville.com
Mar 18, 2018 - Thoughtfly Films launches their second Louisville based feature length film production.
feature lengthaction comedystartsproductionlouisville
https://manpages.ubuntu.com/manpages/questing/man2/nvme_get_feature_length2.2.html
Ubuntu Manpage: nvme_get_feature_length2 - Retreive the command payload length for a specific...
Retreive the command payload length for a specific feature identifier
the commandubuntumanpagenvmeget
https://www.sportswriters.net/usbwa/2024-25-usbwa-best-writing-contest-winner-magazine-length-feature
2024-25 USBWA Best Writing Contest Winner: Magazine-Length Feature
2024-25 USBWA Best Writing Contest Winner: Magazine-Length Feature
writing contestbestwinnermagazinelength
https://www.isca-archive.org/interspeech_2024/zhang24b_interspeech.html
ISCA Archive - Variable Segment Length and Domain-Adapted Feature Optimization for Speaker...
isca archivevariablesegmentlengthdomain