https://www.dnv.com/videos/floating-offshore-wind-the-next-five-years-218639/
Floating offshore wind: The next five years
Design, engineering and certification of floating offshore wind turbines by DNV
floating offshore windthe nextfiveyears
https://www.dnv.com/training/owt-10-modelling-of-floating-offshore-wind-foundation/
OWT-10 Modelling of floating offshore wind foundation
This course focuses on modelling of a floating offshore wind foundation for the purpose of hydrodynamic analysis and structural analysis.
floating offshore windowt10modellingfoundation
https://www.gminsights.com/industry-analysis/north-america-floating-offshore-wind-energy-market
North America Floating Offshore Wind Energy Market Size Report, 2032
North America floating offshore wind energy market size was valued USD 24.1 Million in 2023 and is anticipated to grow at a CAGR of 39.4% from 2024 to 2032...
floating offshore windnorth americaenergy marketsizereport
https://www.plymouth.ac.uk/celtic-sea/facilities
Facilities for floating offshore wind operations - University of Plymouth
University of Plymouth: Explore our critically important resources that support floating offshore wind operators with development, de-risking and deployment
floating offshore windfacilitiesoperationsuniversityplymouth
https://maritime-executive.com/article/marad-receives-proposal-for-floating-offshore-lng-export-terminal-off-texas
MARAD Receives Proposal for Floating Offshore LNG Export Terminal off Texas
With the rush to expand the U.S. LNG export business and strong support from the Trump administration for the energy sector, a developer has filed a n...
floating offshoremaradreceivesproposal
https://www.archdaily.com/138162/floating-offshore-stadium-stadiumconcept
Floating OffShore Stadium / stadiumconcept | ArchDaily
May 25, 2011 - Developed by the german architects stadiumconcept for the FIFA World Cup 2022 the Floating OffShore Stadium represents an extraordinary and ambitious...
floating offshorestadiumarchdaily
https://salamanderfloatingwind.com/
Salamander Project - Floating Offshore Wind Scotland - Simply Blue Energy
floating offshore windsalamanderprojectscotlandsimply
https://www.power-technology.com/news/south-korea-wind-farm/
South Korea plans to build floating offshore wind farm
May 10, 2021 - The Government of South Korea has announced plans to build a 6GW floating offshore wind farm off the coast of Ulsan by 2030.
plans to buildfloating offshore windsouth koreafarm
https://www.rwe.com/en/press/rwe-renewables/2020-10-28-pilot-project-for-floating-offshore-wind-is-picking-up-speed/?
Pilot project for floating offshore wind is picking up speed
Leading global infrastructure operator Ferrovial has been selected for the manufacturing and assembly of the SATH floating platform in the DemoSATH project...
floating offshore windpilot projectpicking upspeed
https://www.power-technology.com/marketdata/pentland-floating-offshore-wind-farm-uk/
Pentland Floating Offshore Wind Farm, UK
Dec 14, 2021 - Pentland Floating Offshore Wind Farm is a 100MW offshore wind power project. It is planned in North Sea, Scotland, the UK.
floating offshore windpentlandfarmuk
https://gcaptain.com/releases-comprehensive-guide-floating/
ABS Releases Comprehensive Guide for Floating Offshore Wind Turbines
Apr 8, 2013 - The American Bureau of Shipping (ABS) has released the ABS Guide for Building and Classing Floating Offshore Wind Turbine Installations to provide the most...
floating offshore windcomprehensive guideabsreleasesturbines
https://offshorewindconference.com/
Floating Offshore Wind Conference
floating offshore windconference
https://www.power-technology.com/news/bluefloat-floating-offshore-wind-italy/
BlueFloat submits EIA for 1.3GW floating offshore wind in Italy
Jan 16, 2024 - BlueFloat Energy, Renantis, submitted an EIA report to the government of Italy for the 1.3GW Odra Energia floating offshore wind project.
floating offshore windsubmitseia1
https://newatlas.com/energy/t-omega-floating-wind/
T-Omega re-thinks floating offshore wind turbines for huge cost savings
Sep 13, 2023 - Boston startup T-Omega Wind says it's prototyped and tested a unique floating offshore wind turbine that can withstand massive storms, but at 20% the weight...
floating offshore wind
https://www.power-technology.com/news/shell-coenshexicon-wind-farm/
Shell and CoensHexicon start JV for floating offshore wind farm
Sep 2, 2021 - Shell Overseas Investment and CoensHexicon have established a joint venture to develop and operate a 1.4GW floating offshore wind project in South Korea.
floating offshore windshellstartjvfarm
https://www.eco-business.com/ms/research/floating-offshore-wind-the-next-five-years/
Floating offshore wind: the next five years | Research | Asia | Sustainable Business
By 2050, we predict that floating offshore wind will generate 264 GW or 15% of all offshore wind energy. To put this into context this is the equivalent to a...
floating offshore windthe nextfive years
https://www.dnv.com/software/training/owt-13-hydrodynamic-analysis-of-floating-offshore-wind-turbine-foundation-time-domain-time-domain-registration-form/?RequestId=110538
OWT-13 Hydrodynamic analysis of floating offshore wind turbine foundation - time domain
This course introduces the participants to the Sesam programs for hydrodynamic analysis of floating offshore wind turbine foundation based on time domain...
floating offshore windhydrodynamic analysis
https://flotationenergy.com/
Flotation Energy - At the vanguard of floating offshore wind
Mar 18, 2026 - Pioneering a sustainable future - Flotation Energy builds and operates offshore wind farms in deep waters, established history and strong track record, we’re...
flotation energythe vanguardfloating offshorewind
https://www.power-technology.com/marketdata/power-plant-profile-sinclair-floating-offshore-wind-project-uk/
Power plant profile: Sinclair Floating Offshore Wind Project, UK
Jun 3, 2024 - Sinclair Floating Offshore Wind Project is a 99.5MW offshore wind power project. It is planned in North Sea, Scotland, the UK.
floating offshore windpower plantprofilesinclairproject
https://asia.guidetofloatingoffshorewind.com/
Guide to a floating offshore wind farm | An informative resource for floating offshore wind
floating offshore windguide toinformative resource
https://www.plymouth.ac.uk/celtic-sea
Floating offshore wind solutions for Celtic Sea developers - University of Plymouth
University of Plymouth: Find out how our unrivalled technical capabilities and expertise can support the successful roll-out of floating offshore wind (FLOW)...
floating offshore windsolutions forceltic sea
https://www.ucc.ie/en/eel/projects/climag/
HyFloat1: Floating Offshore Wind to Hydrogen | University College Cork
Learn, Study and Research in UCC, Ireland's first 5 star university. Our tradition of independent thinking will prepare you for the world and the workplace in...
floating offshore winduniversity collegehydrogencork
https://www.power-technology.com/news/technipfmc-prysmian-floating-offshore-wind/
TechnipFMC and Prysmian advance floating offshore wind projects
Nov 4, 2024 - TechnipFMC and Prysmian have entered a collaboration agreement to enhance the development of floating offshore wind energy.
floating offshore windtechnipfmcprysmianadvanceprojects
https://www.abdn.ac.uk/engineering/news-events/news/22406/
Floating offshore wind project shortlisted in prestigious industry awards | News | The University...
A project led by researchers at the University of Aberdeen has been shortlisted as a finalist in the 2023 Ventus Awards, the offshore wind industry's highest...
floating offshore wind
https://www.bw-ideol.com/en
Floating offshore wind | BW Ideol
floating offshore windbwideol
https://www.researchandmarkets.com/reports/6232874/floating-offshore-wind-market-turbine-rating
Floating Offshore Wind Market by Turbine Rating, Floating Platform, Component, Depth, & Region -...
The Floating Offshore Wind Market, valued at USD 3.16B in 2026, is projected to reach USD 25.4B by 2031, growing at a 51.7% CAGR.
floating offshore windmarket
https://www.power-technology.com/news/shell-cgn-floating-wind/
Shell and CGN cancel floating offshore wind project in France
Nov 16, 2022 - Shell and China General Nuclear Power Group (CGN) have decided to shelve plans to build a floating wind power project in France.
floating offshore windshellcgncancelproject
https://www.maine.gov/energy/initiatives/offshorewind/researcharray/
Gulf of Maine Floating Offshore Wind Research Array | Maine Department of Energy Resources
In 2021, after extensive stakeholder outreach and engagement, Maine applied to the Federal Bureau of Ocean Energy Management (BOEM) to lease a 15.2 square mile...
gulf of mainefloating offshore wind
https://www.rwe.com/en/press/rwe-renewables/2021-11-29-south-korea-rwe-and-ulsan-city-cooperate-in-floating-offshore-wind/?
South Korea: RWE and Ulsan City cooperate in floating offshore wind
RWE and the Ulsan Metropolitan City will cooperate on the development of floating offshore wind projects off the South Korean coast with an envisaged capacity...
south koreafloating offshorerweulsan
https://www.cityam.com/first-floating-offshore-wind-farm-approved-off-welsh-coast/
First floating offshore wind farm approved off Welsh coast
Mar 13, 2023 - Consent for a floating offshore wind farm has been granted off the Pembrokeshire coast, the Welsh government has announced.
floating offshore windfirstfarmapprovedwelsh
https://gcaptain.com/california-ports-strike-landmark-agreement-on-floating-offshore-wind/
California Ports Strike Landmark Agreement on Floating Offshore Wind
Dec 19, 2024 - The California State Lands Commission has partnered with the ports of Long Beach and Humboldt in a groundbreaking agreement to accelerate floating offshore...
landmark agreementfloating offshorecaliforniaportsstrike
https://www.dnv.com/training/se-18-coupled-motion-analysis-and-riser-design-of-floating-offshore-installations-17625/
Coupled motion analysis and riser design of floating offshore installations training
This course introduces the Sesam tool Sima for coupled analysis of floating systems in time domain
motion analysisdesign offloating offshorecoupledriser
https://www.notion.so/I3FLOAT-Floating-Wind-Innovation-Roadmap-2eefe1bc518380b2b99ef1f089fd648f?source=copy_link
I3FLOAT Floating Offshore Wind Strategic Innovation Agenda | Notion
floating offshore windstrategic innovationagendanotion
https://www.rwe.com/en/press/rwe-offshore-wind-gmbh/2023-05-16-tetraspar-demonstrator-launches-global-competition/
Call for innovations in floating offshore wind: TetraSpar Demonstrator launches global competition
RWE and its partners are committed to exploring innovative solutions that can accelerate the technical advancement of floating offshore wind, as well as...
floating offshore windcall for
https://www.woodmac.com/reports/power-markets-floating-offshore-wind-in-pursuit-of-commercialization-30728/
Floating Offshore Wind: In Pursuit of Commercialization Report | Wood Mackenzie
floating offshore windpursuitcommercializationreportwood
https://www.principlepower.com/
A planet powered by floating offshore wind - Principle Power
Principle Power is a global energy technology and services company. The company’s proven WindFloat® product portfolio – consisting of the WindFloat T and...
floating offshore windpowered byplanetprinciple
https://maritime-executive.com/index.php/article/partnership-to-design-next-generation-sov-for-floating-offshore-wind-ops
Partnership to Design Next-Generation SOV for Floating Offshore Wind Ops
A new industry collaboration is being launched by North Star, Vard, and others to solve the challenge of delivering high-performance operations and m...
floating offshore windnext generationpartnershipdesign
https://www.stantec.com/en/ideas/topic/energy-resources/driving-decarbonization-with-renewable-floating-offshore-wind-energy
West Coast floating offshore wind
Floating offshore wind farms are needed for the energy transition. They can help provide renewable energy, especially on the West Coast.
west coastfloating offshorewind
https://www.dnv.com/publications/floating-offshore-wind-in-apac-232533/
Floating offshore wind in APAC
floating offshore windapac
https://fowcoe.co.uk/
Home - Floating Offshore Wind Centre of Excellence
Aug 5, 2024 - ORE Catapult's FOW CoE reduces floating wind costs, accelerates development, fosters innovation, and supports global projects.
floating offshore windcentreexcellence
https://www.power-technology.com/news/norway-proposes-3-3bn-subsidy-for-floating-offshore-wind/
Norway proposes $3.3bn subsidy for floating offshore wind
Oct 9, 2024 - The Norwegian government proposed to offer nearly $3.3bn in subsidies in its floating wind tender, the first of its kind in the country.
floating offshorenorwayproposes3subsidy
https://odfjelloceanwind.com/
Odfjell Oceanwind - Shaping the future of floating offshore wind
Sep 25, 2025 - Combining 50 years of industry experience with the technology of tomorrow, we develop solutions for the changing energy market.
shaping the futurefloating offshoreodfjellwind
https://www.digitimes.com/news/a20230217PD202/offshore-wind-farm.html
Taiwan to boost development of floating offshore wind farms in 3rd phase
As development of offshore wind farms in the first and second phases is in smooth progress, Taiwan's Ministry of Economic Affairs (MOEA) is in preparation to...
floating offshore wind
https://gcaptain.com/autonomous-drones-to-survey-floating-offshore-wind-site-off-california/
Autonomous Drones to Survey Floating Offshore Wind Site Off California
Sep 19, 2023 - A fleet of underwater drones will be used to conduct a comprehensive site survey for what could become the first floating offshore wind farm off the U.S. West...
floating offshore windautonomous dronessurveysitecalifornia
https://www.power-technology.com/news/iberblue-offshore-wind-farm/
IberBlue Wind to build floating offshore wind farm in Portugal
Feb 20, 2023 - IberBlue Wind has unveiled plans to build a floating offshore wind farm in Portugal with an installed capacity of 990MW.
to buildfloating offshorewindfarmportugal
https://cleantechnica.com/tag/floating-offshore-wind/
floating offshore wind Archives | CleanTechnica
floating offshore windarchivescleantechnica
https://floatingtec.com/
Home - Offshore Marine Facility Floating Solution Expert
offshore marinefacilityfloatingsolutionexpert
https://bwoffshore.com/
BW Offshore | Floating Production Solutions
BW Offshore engineers and operates FPSO vessels for deepwater oil and gas production. 40+ years of experience and 99.7% commercial uptime worldwide.
bw offshorefloating productionsolutions
https://ozea-monitoring.com/
Offshore and Floating Wind Condition & Integrity Monitoring - Ozea
floating windintegrity monitoringoffshoreconditionozea
https://www.eni.com/en-IT/media/press-release/2023/01/plenitude-and-simply-blue-group-sign-agreement.html
Plenitude and Simply Blue Group sign agreement to develop floating offshore wind projects in Italy
https://www.businesswire.com/news/home/20220803005411/en/Floating-Offshore-Wind-in-France-TotalEnergies-Corio-Generation-and-Qair-Join-Forces-to-Bid-for-Mediterranean-Tender
Floating Offshore Wind in France: TotalEnergies, Corio Generation and Qair Join Forces to Bid for...
Regulatory News: A consortium of TotalEnergies (Paris:TTE) (LSE:TTE) (NYSE:TTE), Corio Generation and Qair has been pre-selected by the French Directorate Ge...
https://maritime-executive.com/article/first-offshore-hydrogen-production-pilot-begins-tests
First Offshore Floating Hydrogen Production Pilot Begins Tests
The concept of developing hydrogen offshore linked to wind farms is taking a step forward with the first test unit having been dedicated in France. Th...
hydrogen productionfirstoffshorefloatingpilot
https://www.rockwellautomation.com/en-us/company/news/case-studies/llog-improves-reliability--realizes-99-percent-uptime-with-new-o.html
LLOG Improves Reliability, Realizes 99 Percent Uptime with New Offshore Floating Production System...
Offshore exploration and production company achieves 99 percent uptime and improves reliability with flexible, virtualized PlantPAx modern DCS.
https://www.rockwellautomation.com/en-gb/company/news/case-studies/llog-improves-reliability--realizes-99-percent-uptime-with-new-o.html
LLOG Improves Reliability, Realizes 99 Percent Uptime with New Offshore Floating Production System...
Offshore exploration and production company achieves 99 percent uptime and improves reliability with flexible, virtualized PlantPAx modern DCS.
https://www.swimproject.be/
Researching integration of floating solar in offshore wind farms
SWiM aims to research the boundary conditions for safe and effective deployment of offshore photovoltaics in wind farms in the Belgian marine zone.
integration offloating solaroffshore windresearchingfarms
https://www.global.toshiba/ww/news/energy/2023/06/news-20230609-01.html
Toshiba to Promote Technology Development for Large Floating Offshore Wind Farms for Advanced Wind...
floating offshore windtechnology development
https://www.prnewswire.com/news-releases/mainstream-renewable-power-and-maple-power-to-partner-for-upcoming-celtic-sea-floating-offshore-wind-tender-301688566.html
Mainstream Renewable Power and Maple Power to Partner for Upcoming Celtic Sea Floating Offshore...
/PRNewswire/ -- Mainstream Renewable Power ("Mainstream"), the global pure-play renewable energy company majority-owned by Aker Horizons, and Maple Power, a...
mainstream renewable power
https://www.sintef.no/en/publications/publication/2268783/
Fatigue assessment of suspended inter-array power cables for floating offshore wind turbines -...
https://gcaptain.com/wison-vgs-lng-regasification-barge/
Wison Offshore & Marine to Build Floating LNG Regas Barge
offshore marineto buildfloating lngwisonregas
https://www.vestas.com/en/media/company-news/2021/vestas-wins-offshore-order-for-arcadis-ost-1--which-wil-c3373900
Vestas wins offshore order for Arcadis Ost 1, which will utilise industry-first floating...
https://www.opb.org/article/2024/09/16/tribes-file-lawsuit-delay-southern-oregon-floating-offshore-wind-auction/
Tribes file lawsuit to delay Southern Oregon floating offshore wind auction - OPB
The Confederated Tribes of the Coos, Lower Umpqua and Siuslaw Indians filed a lawsuit claiming the federal government failed to consider the environmental,...
floating offshore windsouthern oregon
https://gcaptain.com/classnk-issues-approval-in-principle-aip-for-floating-offshore-hydrogen-production-plant-by-j-deep/
ClassNK issues Approval in Principle (AiP) for floating offshore hydrogen production plant by J-DeEP
Apr 4, 2022 - Leading Classification Society ClassNK has issued an Approval in Principle (AiP) for the design of a floating offshore hydrogen production plant developed by...
https://www.southampton.ac.uk/research/projects/otter-a-novel-offshore-floating-solution-for-hybrid-solar-wind-wave-energy
OTTER: a novel Offshore floaTing soluTion for hybrid solar-wind-wave Energy haRvesting | University...
OTTER: a novel Offshore floaTing soluTion for hybrid solar-wind-wave Energy haRvesting.
https://www.vestas.com/en/media/company-news/2023/vestas-selected-as-preferred-supplier-for-495-mw-floati-c3744994
Vestas selected as preferred supplier for 495 MW floating offshore wind project in South Korea
https://www.power-technology.com/news/haskoning-conduct-eia-gwynt-glas/
Haskoning to conduct EIA for Gwynt Glas floating offshore wind in Celtic Sea
Nov 13, 2025 - Haskoning has been appointed to conduct the environmental impact assessment (EIA) for the Gwynt Glas floating offshore wind project, which aims to deliver up...
floating offshore wind
https://refractor.io/environment/statoilhydro-to-build-2-3mw-offshore-floating-wind-turbine/
StatoilHydro to build 2.3MW offshore floating wind turbine
Sep 13, 2023 - StatoilHydro plans to invest around US$80 million to build a full scale offshore wind turbine using a floating concrete construction similar to those found in...
to buildfloating windstatoilhydro23mw
https://www.iberdrola.com/press-room/news/detail/marranwind-floating-offshore-wind-farm-helps-solve-world-war-i-maritime-mystery
MarramWind floating offshore wind farm helps solve World War I maritime mystery - Iberdrola
Follow the latest news of Iberdrola and its business lines in the economic, financial, operational and sustainability areas
floating offshore wind
https://maritime-executive.com/article/uk-scores-record-round-for-renewables-including-offshore-and-floating-wind
UK Scores Record Round for Renewables Including Offshore and Floating Wind
Officials from the new UK government and industry are all hailing the record results of the sixth round for renewable energy today. After failing to n...
ukscoresrecordround
https://www.rockwellautomation.com/en-fi/company/news/case-studies/llog-improves-reliability--realizes-99-percent-uptime-with-new-o.html
LLOG Improves Reliability, Realizes 99 Percent Uptime with New Offshore Floating Production System...
Offshore exploration and production company achieves 99 percent uptime and improves reliability with flexible, virtualized PlantPAx modern DCS.
https://www.mhi.com/news/120306en.html
Fukushima Recovery, Experimental Offshore Floating Wind Farm Project | Mitsubishi Heavy Industries
A consortium made up of Marubeni (project integrator), the University of Tokyo, Mitsubishi, Mitsubishi Heavy Industries, IHI Marine United, Mitsui Engineering...
floating wind farmmitsubishi heavyfukushimarecoveryexperimental
https://www.pnnl.gov/news-media/floating-offshore-wind-could-bring-billions-value-west-coast-report-shows
Floating Offshore Wind Could Bring Billions in Value to the West Coast, Report Shows | News Release...
Oct 11, 2023 - Floating offshore wind farms could potentially triple the Pacific Northwest's wind power capacity while offsetting billions of dollars in costs for utilities,...
https://www.sintef.no/en/projects/2025/transport-and-installation-of-floating-offshore-wind-turbines-towin-jip-phase-1-towing/
Transport and Installation of Floating Offshore Wind Turbines (TOWIN JIP): Phase 1 - Towing - SINTEF
Phase 1 aims to cut FOWT towing costs by reducing conservatism through better knowledge, validated methods, and a guideline for safe, efficient operations.
https://www.nrc.gov/docs/ML2516/ML25160A281.html
NRC: ML25160A281 - NUREG-0056 Manufacture of Floating Nuclear Power Plants by Offshore Power...
nuclear power plants
https://www.power-technology.com/news/freja-offshore-hexicon-mainstream/
Freja Offshore lodged application for 2.5GW floating wind farm
Nov 1, 2023 - Freja Offshore, a joint venture of Hexicon and Mainstream Renewable Power, lodged an application for a 2.5GW floating wind farm off Sweden.
freja offshorefloating windlodgedapplication2
https://www.mhi.com/technology/review/abstract-52-1-25
Evaluation of Design Loads and Instability of a 7MW Floating Offshore Wind Turbine | Mitsubishi...
https://www.rockwellautomation.com/en-nz/company/news/case-studies/llog-improves-reliability--realizes-99-percent-uptime-with-new-o.html
LLOG Improves Reliability, Realizes 99 Percent Uptime with New Offshore Floating Production System...
Offshore exploration and production company achieves 99 percent uptime and improves reliability with flexible, virtualized PlantPAx modern DCS.