https://www.foodandwine.com/christmas-prime-rib-recipes-11866283
Find the ideal Christmas prime rib recipe for your holiday dinner, with options like a Three-Ingredient Prime Rib Roast, a Garlic-Butter Rib Roast, a Standing...
prime ribbestrecipesfestive
https://www.lifeissuite.com/holiday-helper-thanksgiving-recipes-2/
Aug 4, 2023 - Part 2: Main Dishes Our favorite big bird is an 8-foot-tall yellow Muppet, but coming in a close second is the humble turkey. It’s estimated that more than...
thanksgiving recipesholidayhelperlifesuite
https://www.albany.com/holiday/top-recipes/
Nov 11, 2025 - Need a new holiday recipe for your party? These holiday recipes are a huge hit whether you're staying close to home in Albany, or heading to a loved one's...
holiday recipesalbany nytopfavorites
https://www.tasteofhome.com/collection/christmas-movie-recipes/
Cozy up with Christmas recipes inspired by beloved holiday films. You'll find sweet treats and nostalgic snacks to make movie night magical.
christmas recipespairfavoriteholidayfilms
https://sierranevada.com/blog/food-beer/holiday-beer-recipes
Nov 4, 2025 - From Thanksgiving feasts to Christmas parties, Sierra Nevada beer brings bold, seasonal flavor to dishes that will wow your guests and warm your spirits.
holiday recipescheersflavorusebeer
https://weberseasonings.com/holiday-grilling-recipes/
Nov 18, 2025 - Turn up the heat this holiday season with Weber® recipes for pulled pork, top sirloin roast, and smoked buffalo chicken dip.
grilling recipesholidayseasonings
https://www.skinnytaste.com/holiday-recipes/
Who doesn't love the holidays? With these fun and creative holiday recipes, you'll love them even more! Spread the love this holiday season with good...
holiday recipesbesteveryspecial
https://www.adirondack.net/holiday/top-recipes/
Dec 1, 2025 - Adirondack.net's Facebook fans have shared their favorite Adirondack holiday recipes! Discover everything from snickerdoodles to white chili to pumpkin bread.
holiday recipestopadirondacktreatssnacks
https://www.food.com/ideas/christmas-dinner-ideas-6120
May 2, 2016 - Try these traditional Christmas dinner ideas and recipes and enjoy your favorite mains, sides, appetizers and desserts for the holidays, at Food.com.
christmas dinnerbestrecipesholidayideas
https://www.goodmorningamerica.com/food/story/holiday-cookie-recipes-tips-dan-pelosi-new-york-times-cookbook-128040823
Dec 3, 2025 - Cookbook authors Dan Pelosi, Casey Elsass and Samantha Seneviratne share cookie recipes for the holiday season.
holiday cookiesweetrecipesmakeparty
https://www.ask.com/culture/winter-cocktail-mocktail-recipes-seasonal-sips
May 20, 2025 - The weather outside might be frightful, but our seasonal sips are sure to be delightful! This winter, curl up with these cocktails and mocktails.
seasonalsipsgetholidayspirits
https://10best.usatoday.com/food-drink/leftovers-recipes-by-chefs/
Dec 2, 2025 - Make your holiday leftovers into something special with these chef-provided recipes that eliminate food waste.
leftovers recipeschefstransformholidayscraps
https://makeitdairyfree.com/vegan-last-minute-holiday-recipes-updated-2025/
Nov 27, 2025 - Need a last minute holiday recipe? We got you with all the best easy and quick vegan recipes.
last minuteholiday recipesveganupdatedmake
https://www.shape.com/healthy-eating/healthy-drinks/20-low-calorie-holiday-cocktail-recipes
Toast the holidays with these delicious, low-cal cocktail recipes!
low caloriecocktail recipesholiday
https://pinchofyum.com/recipes/holiday-series
Hellooooo, Holiday Series! Bring on the cookies, the cinnamon rolls, the fancy dips. Merry merry to you and yours with all these fun, nostalgic recipes!
holidayseriesrecipespinchyum
https://www.glensfalls.com/holiday/festive-food/
Oct 8, 2025 - Create the perfect holiday party by following our meal planning tips and holiday recipe suggestions!
top tipsholiday seasonamprecipes
https://www.homecrux.com/category/holiday/
From Halloween decorations and Thanksgiving recipes to Christmas decorations and cocktails, there is something for everyone!
food recipesholidaydecorationideas
https://www.fatherly.com/life/best-holiday-recipes-chefs-prepare-for-family
Feb 20, 2024 - From a spiced, whole-roasted cauliflower to the best almond brittle you’ll ever bite into, these are the holiday recipes professional chefs always serve.
holiday recipeschefsalwaysservefamilies
https://www.hola.com/us/food/20211125306791/classic-holiday-cocktails-using-kendall-jenners-818-tequila/
Nov 25, 2021 - Make these cocktail recipes for Thanksgiving, friendsgiving or the upcoming holiday parties!
classicholidaycocktailsrecipesusing
https://inspiredbycharm.com/
Jan 19, 2026 - Welcome to your go-to inspiration headquarters. Here you'll find approachable recipes, meaningful home decor, festive holiday inspiration, and
recipesdecorholidayinspirationinspired
https://www.salon.com/2025/12/15/6-holiday-recipes-to-try-this-season-courtesy-of-with-love-meghan-holiday-celebration/
Dec 15, 2025 - List featuring six recipes from Meghan Markle's “With Love, Meghan, Holiday Celebration”
holiday recipestryseasoncourtesy
https://ediblecommunities.com/recipes/thanksgiving-recipes-to-curate-your-dinner-menu/
Dec 8, 2025 - From soups and salads, to mains and sides, to desserts and drinks—and what to do with your leftovers!
thanksgiving recipesdinner menucuratebestholiday
https://snappyliving.com/thanksgiving-entree-recipes/
Tired of the same old turkey? Find creative Thanksgiving mains, from vegan roasts to smoked and spatchcock turkey methods, for any guest list.
thanksgivingentreerecipesholidayentertaining
https://www.besthealthmag.ca/list/holiday-cookie-recipes/
These holiday cookie recipes are perfect for your cookie exchange, gift-giving or enjoying with loved ones at home.
holiday cookiebestrecipeswant
https://www.justonecookbook.com/season/holiday-season/
Make Japanese-style holiday recipes like roast beef, miso turkey, and matcha treats—festive, flavorful dishes with a creative Japanese twist!
japanese styleholiday recipesonecookbook
https://www.thedailymeal.com/1472501/holiday-treat-recipes/
Dec 16, 2023 - If you want to make the best treats for a holiday exchange, don't worry; we have everything you need to know. Pick one of these 14 recipes and wow the...
holiday treatrecipesmakeexchange
https://www.eatingwell.com/recipes/22889/mealtimes/breakfast-brunch/holidays-occasions/
Find healthy, delicious breakfast recipes for every holiday and special occasion, including Christmas, Easter and Mother's day ideas for breakfast and...
holidaybreakfastbrunchrecipes
https://www.13wmaz.com/video/syndication/ott/cooking-with-styles/holiday-style-recipes-cooking-with-styles/509-b4c0d702-09ba-44a0-8b2f-c72d78d7d673
Shawn prepares some great side dish recipes that are sure to impress as part of your holiday meal!
holidaystylerecipescookingcom
https://www.realsimple.com/anti-inflammatory-holiday-recipes-8761143
The holidays are a time to eat well and be merry—with this dietitian-approved anti-inflammatory recipes, you can spend the holiday season feeling both...
holiday recipesantiinflammatoryfestivehealthy
https://www.eatingwell.com/spiced-nuts-and-seeds-recipes-easy-holiday-appetizers-11860025
These spiced nut and seed recipes are perfect for hosting this season, whether you opt for a savory, sweet or spicy snack.
spiced nutsseedsrecipes
https://www.foodandwine.com/december-recipes-2025-11859989
Discover new holiday recipes from Food & Wine, including Hannukah and Christmas favorites like a showstopping brisket, sugar cookies, creamy dips, and...
holiday recipesnewmakedecember
https://www.traeger.com/recipes/holiday/christmas
See our 2023 Holiday & Christmas recipes. From Christmas cookies and dessert ideas to prime rib and other Christmas smoker recipes. We have main course,...
christmas recipestraeger grillsholidayamp
https://www.ehow.com/13775802/festivle-holiday-mocktails
Dec 15, 2022 - Whether you're meeting up with old friends at a neighborhood eatery or arriving at a party, you're sure to encounter one question this holiday...
mocktail recipesholiday seasonwinteralcoholfree
https://www.foodandwine.com/holiday-hors-doeuvres-11860184
Bring on the holiday celebration with these party-perfect hors d'oeuvres, including grape crostini, bacon-wrapped scallops, shrimp cocktail, deviled eggs,...
irresistibleholidayappetizerrecipes
https://www.foodandwine.com/quick-cookie-recipes-11864306
Whether you’re baking for Christmas, Hanukkah, Kwanzaa, or New Year’s, these quick cookie recipes are perfect for the busy holiday season. Every cookie,...
cookies recipesholiday seasonquick
https://preservingguide.com/cranberry-canning-recipes/
Nov 10, 2025 - 9 Cranberry Recipes for Canning this holiday season, with tested steps for sauce, jelly, jam, butter, juice, and pie filling, great for gifts and easy sides.
cranberry recipescanningeasyholiday
https://www.sungrownkitchen.com/holiday-recipes/
Dec 16, 2025 - 'Tis the season for parties, traditions and lots of cooking! Find delicious Holiday Recipes from appetizers to side dishes to baking!
holiday recipeskitchen
https://vegoutmag.com/recipes/c-a-very-vegan-christmas-5-must-make-holiday-recipes/
Nov 24, 2025 - Five vegan Christmas dishes with heritage, heart, and plant-powered science that make holiday cooking flavorful, conscious, and unforgettable.
holiday recipesveganchristmasmustmake
https://www.bonappetit.com/story/i-need-festive-holiday-recipes
Dec 11, 2024 - On this episode of Dinner SOS, Chris, Kendra and Jesse talk about all things holidays.
holiday recipesneedfestivebon
https://www.foodandwine.com/holiday-bread-recipes-11867054
Celebrate Hanukkah with challah, Christmas with panettone, and the holiday season with babka, bibingka, gingerbread, and stollen. Serve a slice with coffee or...
holiday breadbestrecipesaround
https://www.tasteofhome.com/holidays-events/holidays/christmas/
Get easy party ideas, plus traditional Christmas recipes that cover appetizers, drinks, dinner and dessert—including Christmas cookie recipes galore.
christmas recipesholidaytaste
https://holidayfoodandfun.com/
Oct 30, 2025 - Holiday Food and Fun is your go-to blog for festive seasonal recipes and party ideas that will bring holiday cheer the entire year, making your next birthday...
holiday foodfunfestiverecipescheer
https://www.focusdailynews.com/holiday-mixology-made-easy-cocktail-recipes-for-every-holiday-gathering/
Dec 9, 2025 - The holiday season brings endless opportunities to gather with the people you love. Whether you're hosting a festive game night, organizing a neighborhood...
easy cocktailholidaymaderecipesevery
https://hoptownchronicle.org/hoptown-chronicle-seeking-holiday-storytellers/
Nov 11, 2025 - Community members can submit their original stories for Hoptown Chronicle's "The Dessert Table" and "Holiday Humor."
holiday storieschronicleseekingrecipes
https://www.slurrp.com/article/rosemary-infused-recipes-for-a-warm-amp-fragrant-holiday-spread-1764223276544
Nov 27, 2025 - Rosemary brings a welcoming, recognisable aroma to holiday cooking and enriches a range of seasonal dishes. Many households rely on the herb during this time...
rosemaryrecipeswarmampfragrant
https://vogueadria.com/detox-juice/
Jan 1, 2026 - Discover two detox juice recipes that support digestion, hydration, and the body’s recovery after the holidays, with expert advice from nutritionists.
postholidaydetoxjuicerecipes
https://thefeed.blog/2025/10/22/protein-packed-holiday-breakfast-recipes/
Oct 22, 2025 - Discover easy, protein-packed holiday breakfast recipes from Tyson Foods, featuring Jimmy Dean® sausage, Wright® Brand bacon and more. These recipes are...
breakfast recipestyson foodsproteinpackedholiday
https://www.goodmorningamerica.com/food/story/easy-christmas-appetizers-add-holiday-table-81752744
Dec 20, 2023 - These festive recipes for holiday appetizers will be a hit on any Christmas table.
save timeeasychristmasappetizerrecipes
https://www.krem.com/article/life/food/recipes/krem-2-christmas-lasagna-recipes-holiday-season/293-5e60f3c5-1dcb-4067-bcbe-8bc8069c8058
KREM 2's Laura Papetti and Vincent Saglimbeni want to share one holiday tradition they have that you can take part in at the comfort of your home!
lasagna recipesholiday seasonkremchristmas
https://vegoutmag.com/recipes/c-these-4-festive-vegan-recipes-make-holiday-hosting-feel-effortless/
Nov 28, 2025 - Four crowd-pleasing plant-based dishes that deliver big flavor, zero stress, and a holiday table everyone remembers.
vegan recipesfestivemakeholidayhosting
https://www.southernliving.com/no-cook-holiday-recipes-11861675
When you’re low on oven space and time, turn to one of these no-cook holiday recipes to help ease holiday kitchen stress.
holiday recipescooksave
https://www.foodandwine.com/holidays-events/thanksgiving/thanksgiving-turkeys
Whether you're looking for a traditional Thanksgiving turkey recipe or seeking to shake things up this year, we've got all your turkey bases covered....
thanksgiving turkeyrecipestastyholiday
https://www.simplyrecipes.com/retro-dessert-recipes-11863540
If you love retro recipes as much as we do, here's a treasure trove of vintage baking recipes from Simply Recipes' favorite community cookbooks,...
dessert recipesretromakerepeatholiday
https://www.pinterest.com/nasdaq/celebrate-with-nasdaq/
Feb 16, 2019 - Tips, tricks and holiday recipes/decorating advice from Nasdaq listed companies. See more ideas about holiday recipes, decorating advice,...
holiday recipescelebratenasdaqideasdecorating
https://www.traeger.com/recipes/holiday
Celebrate the holidays with our lineup of Traeger Christmas & Holiday recipes for all seasons and special occasions. Find festive recipes from prime rib to...
holiday recipeschristmasampgrills
https://www.liquor.com/cocktails-by-occasion-4779403
Celebrate the occasion with the perfect themed cocktail or seasonal drink! These recipes will provide libations for every season, holiday, or time of day.
cocktail recipesholidayoccasion
https://www.goodmorningamerica.com/food/story/bon-appetit-cookie-recipes-128557288
Dec 20, 2025 - Bon Appétit's editors share must-try recipes inspired by their hometowns.
holiday cookiemusttryrecipesbon
https://www.seriouseats.com/holiday-season-recipes-5117984
Apr 7, 2021 - Festive mains, decadent desserts, a plethora of drinks, and cocktail-friendly apps—no matter the holiday, we've got the seasonal recipes you need to celebrate.
holiday recipesseasonal
https://www.all-clad.com/blog/post/Nina-Comptons-Holiday-Table?secret=nNvTaiTk1KvR9NyVq96Llz26MqFuXVsl
Sep 1, 2025 - Enjoy this Nina Compton's Holiday Table made with All-Clad
nina comptonholidaytablerecipes
https://www.foodandwine.com/holidays-events
Jan 4, 2024 - Looking for holiday recipes? Find the best ideas for the holidays and entertaining on Food & Wine with recipes that are fast & easy.
dinner party ideasholiday recipesentertaining
https://flipboard.com/@eatingwell/savor-the-season-easy-holiday-recipes-to-save-for-any-celebration-ijhirat1m06b3l6j
Nov 17, 2025 - These simple, crowd-pleasing recipes will be the main attraction at any festive celebration. From make-ahead breakfasts that cut down morning stress to...
holiday recipessavorseasoneasysave
https://www.butterball.ca/my-absolute-favourite-holiday-leftover-recipes/
Nov 19, 2024 - Enjoy the best holiday leftover recipes from Butterball. Create scrumptious meals from your festive leftovers and make every bite memorable.
leftover recipesabsolutefavouriteholidaybutterball
https://www.kingarthurbaking.com/recipes/collections/classic-holiday-recipes
This lineup of classic holiday recipes has everything you need to plan your baking extravaganza. From gingerbread to yule log, these festive recipes are...
holiday recipesking arthurclassicbaking
https://mysolluna.com/2021/12/10/10-vegan-holiday-drink-recipes/
Nov 11, 2025 - Food and drink are an important part of the holiday season, but they’re not always great for you. Check out 10 of my favorite vegan holiday drink recipes!
holiday drinkveganrecipesperfectfall
https://www.tasteofhome.com/
Search recipes for your favorite desserts, appetizers, main dish recipes, and more. Find an array of easy recipes as well as home cooking tips, kitchen design...
tastefindrecipesappetizersdesserts
https://justforall.com/christmas-chicken-recipes/
Oct 22, 2024 - Look forward to a delicious holiday season with these exciting Christmas chicken recipes. From glazed to stuffed poultry, these dishes will have you feeling...
chicken recipesbestchristmasholidaymeals
https://www.pinterest.com/allrecipes/holidays-special-occasions/
Dec 24, 2025 - All the recipes you need for this year's holidays and your special occasions!. See more ideas about recipes, holiday specials, food.
special occasionsdiscoverholidaysamprecipes
https://www.foodandwine.com/holiday-ham-glaze-recipes-11866410
Glazing a whole ham is an easy way to give it a sweet, sticky shine and turn it into a true centerpiece for any gathering. Mix and match ingredients like...
holiday hamrecipesglazes
https://www.ancestry.com/c/ancestry-blog/entertainment-and-culture/brunch-with-babs-holidays
Learn how the internet's favorite grandma, Brunch with Babs, is preserving her recipes and photos for future generations with Ancestry.
holiday recipesfamily traditionssharesampfestive
https://www.kingarthurbaking.com/blog/2024/11/12/easy-holiday-recipes
In our stunning collection of Bake It Easy: Holiday recipes, we have simple-yet-spectacular recipes for every holiday occasion — and baker.
holiday recipesking arthureasyeverybaking
https://holidayfoodandfun.com/recipes/
Feb 1, 2024 - These are our favorite holiday recipes. We also have more holiday activities, celebrations and DIY ideas for every holiday you love to celebrate. If you only...
holiday foodbrowserecipesfun
https://www.foodandwine.com/holiday-baking-guide-11847947
Holiday baking captures joy and nostalgia. Enjoy these recipes for elevated classics and new twists on cookies, cakes, trifles, and pies.
best tipsfoodampwinetricks
https://www.eatingwell.com/make-ahead-breakfasts-holiday-guests-11848176
Cut down on early morning stress with these make-ahead breakfast recipes that are perfect for serving holiday guests.
breakfast recipesmakeaheadholiday
https://www.hola.com/us/food/20220701327560/4th-of-july-cocktail-drink-recipes/
Jul 1, 2022 - Toast the Fourth of July with these patriotic and summer cocktail recipes.
cocktail recipesfourthjulycelebrateholiday
https://www.slurrp.com/article/indulgent-pistachio-recipes-by-chef-sanjeev-kapoor-for-the-holiday-season-1764572210292
Dec 1, 2025 - Chef Sanjeev Kapoor shares two recipes, created for American Pistachio Growers, that bring a lively mix of freshness and warmth to holiday cooking. One recipe...
indulgentpistachiorecipeschefsanjeev
https://www.justonecookbook.com/best-holiday-recipes-appetizers-mains-desserts/
Nov 4, 2024 - Discover the best holiday recipes—from easy appetizers and fresh salads to Japanese-inspired mains and decadent desserts!
holiday recipesbestonecookbook
https://www.10tv.com/video/syndication/ott/cooking-with-styles/holiday-style-recipes-cooking-with-styles/509-b4c0d702-09ba-44a0-8b2f-c72d78d7d673
Shawn prepares some great side dish recipes that are sure to impress as part of your holiday meal!
holidaystylerecipescookingcom
https://www.wearetateandlylesugars.com/blog/budget-friendly-baking-bank-holiday-recipes/
Mar 13, 2024 - In this article, discover 4 mouth-wateringly delicious savoury recipes and 4 lip-lickingly sweet recipes for you and your loved ones.
budget friendlybank holidaybakingrecipes
https://greatist.com/eat/how-to-make-holiday-cookies
Dec 2, 2021 - If you’re wondering where to begin for a delicious holiday cookie platter, we’ve got you covered. We’re breaking down everything you need to know for...
christmas cookiesmakebestholidayrecipes