https://www.indiehackers.com/
Indie Hackers: Work Together to Build Profitable Online Businesses
Connect with developers sharing the strategies and revenue numbers behind their companies and side projects.
indie hackerswork togetherbuildprofitableonline
https://ailaunch.space/
AI Launch Space - Discover AI tools built by indie hackers and founders
A curated directory of AI tools, agents, and apps. Find your next favorite — or submit yours and reach builders and early adopters.
ai launch spacediscover toolsbuilt byindie hackers
https://waitle.io/
Waitle - Waitlist pages for indie hackers, with referral system
Build a beautiful waitlist or coming soon page in minutes. Built-in referral system, email capture, and native integrations with Resend, Mailchimp, Airtable,...
for indie hackerswaitlistpagesreferralsystem
https://evernote.com/learn/note-taking-tips-for-indie-hackers
Note-Taking Tips for Indie Hackers | Evernote
Discover effective note-taking tips for indie hackers to boost productivity and manage projects efficiently. Embrace smarter note-taking strategies today.
note taking tipsfor indie hackersevernote
https://dev.to/theindiehackerspodcast?page=4
The Indie Hackers Podcast - DEV Community
Conversations with developers about how they're turning their ideas and side projects into profitable businesses.
indie hackers podcastdevcommunity
https://dev.to/theindiehackerspodcast?page=3
The Indie Hackers Podcast - DEV Community
Conversations with developers about how they're turning their ideas and side projects into profitable businesses.
indie hackers podcastdevcommunity
https://index.dodopayments.com/
The Definitive Index of Startups, Indie Hackers, and SaaS Tools – Index
Discover, compare, and explore the best software and startups shaping the future. Stay updated with verified listings, reviews, and alternatives trusted by...
the definitiveindex ofindie hackerssaas toolsstartups
https://tunein.com/podcasts/Business--Economics-Podcasts/The-Indie-Hackers-Podcast-p1133328/
Indie Hackers | Listen to Podcasts On Demand Free | TuneIn
Indie Hackers podcast on demand - Listen to free internet radio, news, sports, music, audiobooks, and podcasts. Stream live CNN, FOX News Radio, and MS NOW....
listen to podcastsindie hackerson demandfreetunein
https://podcasts.apple.com/us/podcast/indie-hackers/id1206165808
Indie Hackers - Podcast - Apple Podcasts
Listen to Courtland Allen and Channing Allen's Indie Hackers podcast with Courtland Allen and Channing Allen on Apple Podcasts.
indie hackers podcastapplepodcasts
https://seggwat.com/
Feedback & Live Chat Widget for Indie Hackers & Small Teams — SeggWat
The fastest way for solo founders to understand users and ship the right features. Feedback, ideas, and live chat in one widget — from $6/mo, not $79/seat.
live chat widgetfor indie hackerssmall teamsfeedback
https://getspec.ai/
Spec — AI Product Manager Agent for Founders & Indie Hackers
Spec is an adaptive AI agent that automates product discovery. JTBD framing, market sizing, competitor analysis, persona simulation, and a full...
ai product managerfor foundersspecagentindie
https://listmysaas.xyz/
ListMySaaS — Free SaaS directory for founders, makers, and indie hackers
ListMySaaS is a free SaaS directory for founders, makers, and indie hackers. Browse AI, productivity, marketing, and SEO tools; submit your SaaS for a dofollow...
saas directoryfor founderslistmysaasfree
https://solopreneurpage.com/
Startup portfolio for solopreneurs and indie hackers
Your portfolio home for everything you build – not just links, but real visibility for solopreneurs and indie hackers. Live in 2 minutes.
startup portfoliofor solopreneursindiehackers
https://www.indiehackers.com/sign-in
Indie Hackers
indiehackers
https://www.indiehackers.com/post/why-i-built-fig0-the-frustration-that-fueled-a-fair-ai-directory-pwEDFjlNOISrXqr2ZRCM
Why I Built AI Just Better: The Frustration That Fueled a Fair AI Directory - Indie Hackers
Mar 9, 2026 - For months, I was drowning in the AI tool ocean. Every day, a new “revolutionary” tool popped up. Every platform claimed to be the “#1 alternative.” But...
https://aruana.top/
Aruana - Domain Discovery & Project Ideas Platform for Indie Hackers
Discover available .br domains, find project ideas, and validate your next indie project. SEO tools, domain metrics, and Web Archive data for smart builders.
discovery projectideas platformaruanadomainindie
https://www.codu.co/
Codú — the community for AI builders & indie hackers
Learn to build with AI, share what you ship, and grow with people doing the same. A curated feed of articles, tips, questions, and links from the community.
the communityfor aibuildersindiehackers
https://www.indiehackers.com/post/why-i-built-ai-just-better-the-frustration-that-fueled-a-fair-ai-directory-pwEDFjlNOISrXqr2ZRCM
Why I Built AI Just Better: The Frustration That Fueled a Fair AI Directory - Indie Hackers
Mar 9, 2026 - For months, I was drowning in the AI tool ocean. Every day, a new “revolutionary” tool popped up. Every platform claimed to be the “#1 alternative.” But...
https://www.indiehackers.com/groups
Groups for Indie Hackers
See which topics indie hackers are discussing the most while helping each other build profitable online businesses.
groupsindiehackers
https://www.indiehackers.com/post/riding-out-failures-to-bootstrap-a-220k-mo-saas-company-f2L8iDrT0pxUnBfA2zN4
Riding Out Failures to Bootstrap a $220k/mo SaaS Company - Indie Hackers
Jul 31, 2018 - Hello! What's your background, and what are you working on? My name is Peter. I’m from Slovakia and am the founder and CEO of Mangools. I started progra...
riding out
https://www.aruana.top/
Aruana - Domain Discovery & Project Ideas Platform for Indie Hackers
Discover available .br domains, find project ideas, and validate your next indie project. SEO tools, domain metrics, and Web Archive data for smart builders.
discovery projectideas platformaruanadomainindie
https://vibecodingauthority.com/vibe-coding-for-solo-founders/
Vibe Coding for Solo Founders and Indie Hackers
Solo founders and indie hackers operate under a structural constraint that defines every build decision: time and capital are finite, and engineering headcount...
for solo foundersvibe codingindiehackers