Robuta

https://marifa.io/ Marifa: Islamic Shariah-Compliant AI Marifa is the world's first Shariah-compliant AI assistant. Get authentic Islamic guidance grounded in Quran and Sunnah. Access prayer times, Qibla direction,... islamic shariahmarifacompliantai https://daruliftasaylani.com/ Darul Ifta Saylani – Online Islamic Fatwa & Shariah Guidance Saylani Welfare ka official Islamic fatwa portal. Authentic shariah hidayat aur deeni masail ka hal hasil karein. Muftian e karam se rahnumai. darul iftaonlineislamicfatwashariah https://www.zawya.com/press-release/companies-news/emirates-islamic-partners-with-leonteq-to-unveil-innovative-shariah-compliant-structured-products-g3dlfemv Emirates Islamic partners with Leonteq to unveil innovative Shariah-compliant structured products This milestone collaboration will expand the Shariah-compliant product offering of Emirates Islamic in the Wealth Management domain emirates islamic https://www.atlantis-press.com/proceedings/icombest-21/125964964 Shariah Governance in Islamic Financial Institutions in Nigeria: An Empirical Study | Atlantis Press This study examines the elements of Shariah governance in Islamic financial institutions in Nigeria. In this study, a quantitative research method is utilized... financial institutions https://www.sc.com/en/wealth-retail-banking/islamic-banking/islamic-banking-disclaimers/ Islamic Banking: Shariah Disclaimer | Standard Chartered Oct 31, 2025 - Read the Islamic Banking disclaimer. Learn how we define Shariah-compliant products, supervisory approvals and client responsibilities in detail. Read more. islamic bankingshariahdisclaimerstandardchartered https://archive.org/details/maqasidalshariah0000auda?view=theater&ui=embed&wrapper=false Maqasid al-shariah as philosophy of Islamic law : a systems approach : Auda, Jasser : Free... xxviii, 347 pages : 24 cm https://www.theblaze.com/news/2011/10/13/sudan-president-vows-new-all-islamic-constitution-shariah-based-legislation Sudan President Vows New All-Islamic Constitution, Shariah-Based Legislation | Blaze Media Jun 17, 2020 - "The official religion will be Islam and Islamic law the main source." new allislamic constitution https://www.lseg.com/en/ftse-russell/indices/islamic-index FR Ideal Ratings Shariah-compliant Islamic Indices | LSEG FR Ideal Ratings Shariah-compliant Islamic Indices provides a comprehensive suite of Malaysian bond indices, using extensive experience of Bond Pricing Agency. shariah compliantfridealratingsislamic https://www.mayerbrown.com/de/news/2022/11/esg-and-shariah-familiarity-driving-islamic-fund-activities ESG and Shariah familiarity driving Islamic fund activities | News | Mayer Brown Despite rising inflationary pressures and the threat of a global recession looming, Islamic funds and investment activities are picking up, according activities newsesgshariahfamiliaritydriving https://www.sc.com/en/wealth-retail-banking/islamic-banking/ Islamic Banking: Shariah solutions | Standard Chartered Nov 14, 2025 - Discover Saadiq Islamic Banking with fully Shariah-compliant solutions across Asia, Africa and the Middle East, delivering innovative wealth services. Learn... islamic bankingshariahsolutionsstandardchartered https://archive.org/details/maqasidalshariah0000auda Maqasid al-shariah as philosophy of Islamic law : a systems approach : Auda, Jasser : Free... xxviii, 347 pages : 24 cm https://www.bis.org/review/r181003d.htm Abdul Rasheed Ghaffour: Roundtable Meeting of Centralised Shariah Advisory Authorities in Islamic... Welcoming remarks by Mr Abdul Rasheed Ghaffour, Deputy Governor of the Central Bank of Malaysia (Bank Negara Malaysia), at the Roundtable Meeting of... abdul rasheed