https://dbm.com.au/find-where-in-the-world-your-best-customers-are-from-with-locations-in-kissmetrics/
Find Where in the World Your Best Customers Are From With Locations in Kissmetrics | digital...
where in the world
https://kissmetrics.io/glossary/product-view-to-cart-rate
Product View to Cart Rate - What It Is, How to Calculate & Track It | KISSmetrics
Product view to cart rate is the percentage of product page views that result in the item being added to the shopping cart. It measures how effectively...
what it isproduct viewto cart
https://cmscritic.com/kissmetrics-updated-with-color-customization-custom-date-filters-multi-touch-attribution
Kissmetrics Updated With Color Customization, Custom Date Filters & Multi-Touch Attribution | CMS...
Aug 31, 2023 - Kissmetrics, the renowned analytics and marketing platform, has rolled out some notable updates. The popular platform can segment audiences, configure...
color customization
https://www.kissmetrics.io/
KISSmetrics - Person-Level Analytics | Track Users, Grow Revenue
KISSmetrics tracks individual users across devices and sessions. Understand complete customer journeys, attribute revenue, and grow with behavioral analytics.
kissmetricspersonlevelanalyticstrack
https://kissmetrics.io/compare/optimizely
KISSmetrics vs Optimizely (2026) - Full Feature Comparison | KISSmetrics
Compare KISSmetrics and Optimizely side-by-side. Feature tables, pricing, migration guides, and an honest assessment of both platforms.
vs optimizelykissmetricsfullfeaturecomparison
https://kissmetrics.io/glossary/time-decay-attribution
Time-Decay Attribution - What It Is, How to Calculate & Track It | KISSmetrics
A multi-touch attribution model that assigns increasing credit to touchpoints closer to the conversion event, based on the assumption that more recent...
what it ishow to calculatetimedecayattribution
https://www.searchenginejournal.com/origin-stories-powerful-blogs-kissmetrics-built-reputation-putting-great-content/130742/
KISSmetrics: Building a Reputation for Great Content | SEJ
May 27, 2015 - Sean Work of KISSmetrics shares what they did in the early days of the blog to help them get to where they are today.
building agreat contentkissmetricsreputationsej
https://kissmetrics.io/glossary/propensity-modeling
Propensity Modeling - What It Is, How to Calculate & Track It | KISSmetrics
A statistical technique that scores individual users on their likelihood to take a specific action, such as purchasing, churning, or upgrading.
what it ishow to calculatepropensity modelingtrackkissmetrics
https://kissmetrics.io/glossary/annual-contract-value
Annual Contract Value (ACV) - What It Is, How to Calculate & Track It | KISSmetrics
The average annualized revenue per customer contract. Used to understand the typical deal size and compare sales productivity across segments.
annual contract valuewhat it ishow to calculate
https://www.kissmetrics.io/compare
Compare KISSmetrics vs 100 Analytics Tools | Feature Comparisons | KISSmetrics
See how KISSmetrics compares to every analytics tool on the market - Mixpanel, Amplitude, GA4, Hotjar, Segment, and 90+ more. Side-by-side feature comparisons,...
analytics toolscomparekissmetricsvsfeature
https://www.research-live.com/article/news/kissmetrics-chief-says-tracking-lawsuits-are-meritless/id/4005768
Kissmetrics chief says tracking lawsuits are 'meritless' | News | Research Live
Breaking market research news, latest job vacancies, industry reports, in-depth analysis and cutting-edge opinion for customer insight professionals.
kissmetricschiefsaystrackinglawsuits
https://kissmetrics.io/glossary/rage-click
Rage Click - What It Is, How to Calculate & Track It | KISSmetrics
A rage click is a rapid sequence of repeated clicks on the same area of a web page, typically three or more clicks within a short time window, indicating user...
what it ishow to calculateragetrackkissmetrics
https://www.kissmetrics.io/industries/ecommerce
E-commerce Analytics | KISSmetrics
E-commerce success isn't about more traffic - it's about converting the traffic you have. KISSmetrics shows you exactly where customers drop off, what driv...
e commerceanalyticskissmetrics
https://www.johnfdoherty.com/landing-pages-that-rank/kissmetrics-1/
kissmetrics-1 - John Doherty
kissmetricsjohndoherty
https://www.tgtbuy.com/tag/kissmetrics-affiliate-program/
kissmetrics affiliate program - TGTBUY
affiliate programkissmetrics
https://bestsaasdeal.com/product/kissmetrics-lifetime-deal/
Kissmetrics Lifetime Deal Review ($59) - SaaS LTD Deals
lifetime dealkissmetricsreviewsaasltd
https://kissmetrics.io/compare/piwik-pro
KISSmetrics vs Piwik PRO (2026) - Full Feature Comparison | KISSmetrics
Compare KISSmetrics and Piwik PRO side-by-side. Feature tables, pricing, migration guides, and an honest assessment of both platforms.
vs piwik prokissmetricsfullfeaturecomparison
https://kissmetrics.io/glossary/deferred-revenue
Deferred Revenue - What It Is, How to Calculate & Track It | KISSmetrics
Revenue that has been collected from customers but not yet earned because the service or product has not yet been delivered. Recorded as a liability on the...
what it ishow to calculatedeferred revenuetrackkissmetrics
https://fivetran.com/docs/connectors/applications/kissmetrics
Kissmetrics data connector by Fivetran | Fivetran documentation
Connect your Kissmetrics data to your destination using Fivetran. Learn about configuration requirements, setup, and ERDs with our technical documentation.
data connectorkissmetricsfivetrandocumentation
https://contently.com/topic/kissmetrics/
Tag: KissMetrics - Contently
Articles tagged with: KissMetrics
tagkissmetricscontently
https://www.kissmetrics.io/industries/sales-led
Sales-Led Analytics | KISSmetrics
In sales-led organizations, the buying journey is long and complex. KISSmetrics helps you track every touchpoint, understand which marketing efforts influe...
salesledanalyticskissmetrics
https://www.kissmetrics.io/demo
Book a Personalized Demo - See Person-Level Analytics in Action | KISSmetrics
Schedule a 1-on-1 walkthrough of KISSmetrics. See how person-level tracking, funnels, cohort analysis, and revenue attribution work for your specific business.
book a personalized demoin actionsee
https://kissmetrics.io/compare/growthbook
GrowthBook vs KISSmetrics (2026) - Which Is Better? | KISSmetrics
KISSmetrics vs GrowthBook - honest comparison of features, pricing, and real strengths of each platform. See which one fits your team.
which isgrowthbookvskissmetricsbetter
https://www.tgtbuy.com/tag/kissmetrics/
kissmetrics - TGTBUY
kissmetrics
https://www.kissmetrics.io/industries/saas
SaaS Analytics | KISSmetrics
In SaaS, retention is everything. KISSmetrics helps you understand how users adopt your product, what drives them to stay, and what signals churn before it...
saas analyticskissmetrics
https://kissmetrics.io/compare/keen
Keen vs KISSmetrics (2026) - Which Is Better? | KISSmetrics
KISSmetrics vs Keen - honest comparison of features, pricing, and real strengths of each platform. See which one fits your team.
which iskeenvskissmetricsbetter
https://airbyte.com/connectors/kissmetrics
ETL to Kissmetrics | Open-source Data Integration | Airbyte
The Airbyte Kissmetrics ELT data integration destination connector will replicate your data from APIs, databases and files to Kissmetrics Sources
open source dataetlkissmetricsintegrationairbyte