https://www.anniesattic.com/shop/knit/patterns/projects-for-the-home
Knit Patterns & Projects for the Home | Annie's Attic
Warm your home with handstitched knitted accessories! Shop knitting patterns for the home with projects like throw blankets, place mats, and beautiful decor.
projects for the homeknit patternsannieattic
https://derpymonster.com/knit-sweater-vest
The 20 Best Knit Sweater Vest Patterns for Women | Derpy Monster
Browse trendy knit sweater vest patterns for women, from beginner-friendly designs to statement pieces. Cozy, stylish, and perfect for layering.
patterns for womenknit sweaterbest
https://www.letsknit.co.uk/free-knitting-patterns/ice-creams-ice-lolly
Ice Creams & Ice Lolly | Knitting Patterns | Let's Knit Magazine
All of the fun and none of the calories, try our knitted ice creams
ice creamsknitting patternslollyletmagazine
https://knitsquare.com/pattern/1368/kettle
Knit Square - Thousands of motif knitting patterns
Knit Square is a repository of motif knitting patterns. All patterns are customizable for a perfect fit to your knitting style, tension and yarn. From small...
thousands ofknitsquaremotifpatterns
https://www.crochetbeja.com/category/crochet/scarf/
Scarf - Crochet & Knit by Beja - Free Patterns, Videos + How To
Explore unique content for the Scarf category. Keep reading and searching to get inspired.
free patternsscarfcrochetknitbeja
https://www.letsknit.co.uk/free-knitting-patterns/rainbow-rattles
Rainbow Animal Baby Rattles Toy Knitting Pattern | Knitting Patterns | Let's Knit Magazine
Use small amounts of colourful yarn to create a whole collection of Sachiyo Ishii's baby-friendly toys.
toy knitting patternbaby rattles
https://knitsquare.com/pattern/1534/coffee-cup
Knit Square - Thousands of motif knitting patterns
Knit Square is a repository of motif knitting patterns. All patterns are customizable for a perfect fit to your knitting style, tension and yarn. From small...
thousands ofknitsquaremotifpatterns
https://knit-knit.com/free-knitted-balaclava-patterns/
12 Free Knitted Balaclava Patterns - Knit-Knit
Dec 9, 2025 - Stay warm in style with these fun and Free Knitted Balaclava Patterns. Perfect for adding a splash of style to winter outfits.
freeknittedbalaclavapatterns
https://www.crochetbeja.com/knit-peanut-braid-stitch-you-need-to-learn/peanut-braid-stitch/
Peanut Braid Stitch - Crochet & Knit by Beja - Free Patterns, Videos + How To
Jan 3, 2020 - Read more about Peanut Braid Stitch
https://www.letsknit.co.uk/free-knitting-patterns/mini-london-bus
Mini London Bus | Knitting Patterns | Let's Knit Magazine
Knit a toy London bus with yarn from your stash!
knitting patternsminilondonbuslet
https://lanahobby.blogspot.com/
Lana creations My knitting work, knit project and free patterns catalogue
My knitting pattern, crochet pattern, shop online, knitting free patterns, jewelry, earrings, necklaces.
my knittingfree patternslanacreationswork
https://freecuteknit.com/new-users/
New Users - Free Cute Knitting Patterns | How to Knit Tutorials
Create an Account Your username must be unique, and cannot be changed later. We use your email address to email you a secure password and verify your account....
how to knitnew usersknitting patternsfreecute
https://www.anniesattic.com/shop/knit/patterns/annie-s-signature-designs/for-the-home
Knit ASD Patterns for the Home | Annie's Attic
Shop our Signature Designs for exclusive home decor knit patterns. Find gorgeous afghan and throw knit patterns as well as pillows and whimsical decor.
patterns for the homeknitasdannieattic
https://www.knittingpatternsdiy.com/how-to-knit-frilly-skirt-crochet-step-by-step/
How to knit Frilly Skirt Crochet Step by Step? - Knitting Patterns DIY
Jul 26, 2023 - Click here to get the free pattern:
how to knitknitting patternsskirt
https://ulvenknit.com/
Ulvenknit — Knitting Patterns by Lív Ulven – Ulven Knit
Modern, size-inclusive knitting patterns. Slow, considered sweater and accessory designs — carefully constructed and made to wear for years.
knitting patternsulven
https://www.crochetbeja.com/category/crochet/coin-purse/
Coin Purse - Crochet & Knit by Beja - Free Patterns, Videos + How To
Explore unique content for the Coin Purse category. Keep reading and searching to get inspired.
coin pursefree patternscrochetknit
https://www.letsknit.co.uk/free-knitting-patterns/knitted-mouse-chocolate-orange-cover
Knitted Mouse Chocolate Orange Cover | Knitting Patterns | Let's Knit Magazine
A knitted Christmas mouse pattern is the perfect addition to your Chocolate Orange covers collection
chocolate orangeknitting patternsknittedmousecover
https://www.onthecuttingfloor.com/10-free-patterns-pretty-knit-projects-to-warm-up/
10 FREE PATTERNS: pretty knit projects to warm up - On the Cutting Floor: Printable pdf sewing...
Dec 8, 2022 - Hello there, 10 FREE PATTERNS: pretty knit projects to warm up Thank you for visiting On the Cutting Floor today. I am happy to present this compilation of 10...
https://www.rukeknit.com/11-knitting-patterns-english?cat=16&needles_patt=5448&price=-10&stitch_patt=5462&yarn_weight=5502&page=3
Easy-to-Follow Knitting Patterns | Ruke Knit (3)
Discover unique, hand-knit designs with Ruke Knit. Our patterns make it easy to create beautiful, timeless pieces, from cozy cardigans to intricate...
to followknitting patternseasy
https://www.theknitcrew.com/4-free-knit-pet-house-patterns-for-cats-and-kittens/
4 Free Knit Pet House Patterns For Cats and Kittens - The Knit Crew
Oct 1, 2024 - Looking for a great gift for your cat? Here are 4 free knit pet house patterns you can try out. Curated by Arty Crafty Crew.
cats and kittenspet house
https://marlybird.com/blog/christmas-stocking-patterns/
20+ Free Crochet & Knit Christmas Stocking Patterns to... | Marly Bird
Apr 7, 2026 - An heirloom Christmas begins and ends with a stocking hung by the fireplace. We've got the perfect selection of patterns just for you!
free crochetchristmas stockingknitpatternsmarly
https://www.baby-knitting-patterns.com/free-baby-knitting-pattern.html
Free baby knitting pattern | Baby knitting patterns free |free knit baby pattern
Lovely design, free baby knitting pattern, easy to knit
knitting patternfreebabypatterns
https://knit-knit.com/knitted-tissue-dispenser-free-patterns/
9 Knitted Tissue Dispenser Free Patterns - Knit-Knit
Apr 15, 2026 - Need a neat cover for your tissue box? Check out Knitted Tissue Dispenser Free Patterns and make a soft, stylish holder with ease.
tissue dispenserfree patternsknitted
https://www.rukeknit.com/11-knitting-patterns-english?cat=22&price=-10&stitch_patt=5462&yarn_patt=5477&page=2
Easy-to-Follow Knitting Patterns | Ruke Knit (2)
Discover unique, hand-knit designs with Ruke Knit. Our patterns make it easy to create beautiful, timeless pieces, from cozy cardigans to intricate...
to followknitting patternseasy
https://www.crochetbeja.com/tag/crochet-blanket-stitch/
crochet blanket stitch Archives - Crochet & Knit by Beja - Free Patterns, Videos + How To
The tag archive for crochet blanket stitch . This is the most beatiful collection of crochet blanket stitch you have ever seen.
crochet blanket
https://www.knit-the-cat.com/en/knitting-patterns/boleros/
Boleros | Knitting Patterns | Knit The Cat
knitting patternsboleroscat
https://www.letsknit.co.uk/free-knitting-patterns/vegalong-part-two
Happy Harvest Veg-along part two | Knitting Patterns | Let's Knit Magazine
With a fine haul of produce from part one, every gardener needs this handy bag to bring in their veggies
happy harvestpart two
https://www.newriverartandfiber.com/product/base-doodle-patterns-by-pacific-knit-co-/2583
Base Doodle Patterns by Pacific Knit Co. | New River Art & Fiber
Base Doodle Pattern Brochures by Pacific Knit Co. are garment patterns specifically designed to be used with all of the motifs available in their Doodle Card...
pacific knit codoodle patternsnew riverbase
https://knit-knit.com/knitted-kitten-dolls-free-patterns/
10 Knitted Kitten Dolls Free Patterns - Knit-Knit
Jan 23, 2026 - Knitted kitten dolls free patterns with easy instructions. Make soft kitten toys using simple stitches, great for beginners and gifts.
free patternsknittedkittendolls
https://knit-n-roll.com/categorie-produit/knit-knitting-set-patterns-beanie-snood-headband/
Knit a Set Beanie Snood Headband Patterns to download - Knit'n'Roll
to downloadknitsetbeaniesnood
https://www.letsknit.co.uk/free-knitting-patterns/lace_trim
Lace Trim | Knitting Patterns | Let's Knit Magazine
Accessorises A Pair Of Cut-off Shorts With A Lace Trim
lace trimknitting patternsletmagazine
https://www.letsknit.co.uk/free-knitting-patterns/faux-fur-jumper
Faux Fur Jumper | Knitting Patterns | Let's Knit Magazine
We love blending different yarns and shades together to make our projects more unique and this stunning roll-neck jumper is no exception. Soft and...
faux furknitting patternsjumperletmagazine
https://www.crochetbeja.com/crochet-hinged-eyeline-pattern-beret-hat/crochet-beret-hat/
Crochet Beret Hat - Crochet & Knit by Beja - Free Patterns, Videos + How To
Feb 13, 2020 - Read more about Crochet Beret Hat
beret hatfree patternscrochetknit
https://www.crochetbeja.com/baby-knit-shoes-you-can-make-easily/knitted-baby-shoes-tutorial-sided/
Knitted Baby Shoes Tutorial Sided - Crochet & Knit by Beja - Free Patterns, Videos + How To
Nov 23, 2020 - Read more about Knitted Baby Shoes Tutorial Sided
https://www.rukeknit.com/11-knitting-patterns-english?knitwear_type=5435&sleeve_patt=5460%2C5459&stitch_patt=5464%2C5463&page=3
Easy-to-Follow Knitting Patterns | Ruke Knit (3)
Discover unique, hand-knit designs with Ruke Knit. Our patterns make it easy to create beautiful, timeless pieces, from cozy cardigans to intricate...
to followknitting patternseasy
https://knit-knit.com/free-knitted-cable-sweater-patterns/
14 Free Knitted Cable Sweater Patterns - Knit-Knit
Nov 26, 2025 - Explore the beautiful collection of Free Knitted Cable Sweater Patterns. They are warm, stylish, and as playful as they are comfy.
sweater patternsfreeknittedcable
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=10757
Game Day Afghan Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet patterngame dayafghancrochetingpatterns
https://knithacker.com/2016/12/4-knit-and-crochet-armadillo-patterns-this-post-is-dedicated-to-matthew-mcconaughey-willie-nelson-and-oddballs-everywhere/
6 Knit and Crochet Armadillo Patterns! - This Post is Dedicated to Matthew McConaughey, Willie...
Dec 23, 2016 - UPDATED 12/24/2019: TWO NEW PATTERNS ADDED TO MAKE IT SIX!
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=13079
Ring-Centered Granny Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet patternringcenteredgrannycrocheting
https://www.ribbonrose.co.nz/products/category/265/776/petite-knit/baby-patterns
Petite Knit Baby Patterns
Baby Patterns from Petite Knit
petite knitbabypatterns
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=11695
4 1/2 Hour Afghan by Lion Brand Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
https://knithacker.com/2016/12/9-popular-ponytail-hats-a-roundup-of-paid-free-patterns/
9 Popular Ponytail Hats and Messy Bun Beanies - a Roundup of Paid & Free Patterns in Knit & Crochet...
Dec 8, 2016 - UPDATED: For more messy bun patterns and tutorials -- both knit and crochet -- see the collection of links at the end of this post.
https://www.scrappony.com/
Scrap Pony | Free Patterns : Quilting - Sewing - Knit - Crochet
Free Patterns : Quilting - Sewing - Knit - Crochet
free patternsscrapponyquiltingsewing
https://www.crochetbeja.com/knit-peanut-braid-stitch-you-need-to-learn/knit-peanut-braid-stitch-sided/
Knit Peanut Braid Stitch Sided - Crochet & Knit by Beja - Free Patterns, Videos + How To
Jan 3, 2020 - Read more about Knit Peanut Braid Stitch Sided
https://www.letsknit.co.uk/free-knitting-patterns/100-days-of-patchwork-bonus-patterns-templates-issue-2
100 Days of Patchwork Bonus Patterns Templates Issue 2 | Knitting Patterns | Let's Knit Magazine
Here are your free full-size pattern templates to accompany your issue of 100 Days of Crafts. Enjoy!
https://craftanddesign.net/cable-knitting-patterns/
22 Cable Knitting Patterns Discovering Intricate Knit Designs - Craft & Design
Jul 22, 2024 - Elevate your knitting with our chic cable patterns. Create cozy and stylish designs for a snug winter wardrobe. Explore now
cable knitting patternsdiscoveringintricatedesignscraft
https://www.letsknit.co.uk/free-knitting-patterns/category/baby-booties
Baby Booties | Free Knitting Patterns | Let's Knit Magazine
Choose from 100s of free knitting patterns to download and make today!
free knitting patternsbaby bootiesletmagazine
https://knithacker.com/2020/10/crochet-a-set-of-wired-arms-legs-pattern-for-any-holiday-pumpkin/
Unique Knit & Crochet Patterns For Halloween and Beyond! - KnitHacker: Where Art & Yarn Hook Up!
Oct 23, 2020 - Halloween is an opportunity to be really creative and these patterns prove it!
https://www.crochetbeja.com/crochet-easy-flower-motif-a-delicate-touch-for-your-next-project/crochet-easy-flower-motif-pattern/
Crochet Easy Flower Motif Pattern - Crochet & Knit by Beja - Free Patterns, Videos + How To
Jun 6, 2025 - Read more about Crochet Easy Flower Motif Pattern
https://www.letsknit.co.uk/free-knitting-patterns/christmas-wreath-knitalong-part-3
Christmas Wreath Knitalong Part 3 | Knitting Patterns | Let's Knit Magazine
Add an adorable elf with Part 3 of Sachiyo Ishii's Christmas Wreath Knitalong
christmas wreathknitting patternspart
https://lindehobby.co.uk/interior-601/
Interior patterns - Free patterns for both knit and crochet
Interior patterns - Huge selection of quality patterns from all major brands - Get the best prices for yarn here - Buy today
for bothinteriorpatternsfreeknit
https://www.letsknit.co.uk/free-knitting-patterns/100-days-of-crochet-classic-bonus-patterns-templates-issue-15
100 Days of Crochet Classic Bonus Patterns Templates Issue 15 | Knitting Patterns | Let's Knit...
Here are your free full-size pattern templates to accompany your issue of 100 Days of Crafts. Enjoy!
https://bezgranic.magnit.ru/read/free-knit-afghan-patterns-worsted-weight.html
Free Knit Afghan Patterns Worsted Weight About 51 X 58, Plus Fringeskill Level: - Printable...
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=8951
Marlo's February Sampler Square #2 Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet pattern
https://knit-knit.com/leftover-yarn-knitting-ideas-free-patterns/
11 Leftover Yarn Knitting Ideas Free Patterns - Knit-Knit
Apr 20, 2026 - Make the most of the bits of yarn with these Leftover Yarn Knitting Ideas Free Patterns, which are creative ideas.
leftover yarnknitting ideasfree patterns
https://ebabypatterns.com/product/heirloom-collection-2-knit-crochet-patterns-book
HEIRLOOM COLLECTION 2 KNIT & CROCHET PATTERNS BOOK | ebabypatterns.com
heirloom collectionknit crochetpatternsbook
https://www.letsknit.co.uk/crochet-patterns/amigurumi-reindeer-decoration-crochet-pattern
Amigurumi Reindeer Decoration Crochet Pattern | Crochet Patterns | Let's Knit Magazine
Use your DK yarn to crochet Sarah Shrimpton's easy Rudolph Christmas decoration pattern
crochet patternamigurumireindeerdecorationpatterns
https://www.lapdogcreations.com/2010/09/review-knit-socks-17-classic-patterns.html
Lapdog Creations: REVIEW: Knit Socks! 17 Classic Patterns for Cozy Feet
Sep 4, 2010 - Pet lifestyle blog following 3 rescue dogs and their multi-tasking Mom who loves to knit and create. Dog Products. Reviews. Training. Life with Dogs.
classic patternscreationsreviewknitsocks
https://knitsewquilt.nz/knit-crochet/knitting-patterns-books/patterns-by-brand/sirdar-patterns/
Sirdar & DMC Knitting Patterns | Knit Sew and Quilt NZ
Create stunning knitwear with Sirdar and DMC patterns, offering a range of stylish, high-quality designs to inspire your next knitting or crochet project.
knitting patternssirdardmcsewquilt
https://www.craftfreely.com/free-crochet-patterns/view-patterns.cfm?category=baby%20onesies
Free Crochet Patterns - Baby onesies - 14 Crochet Patterns and Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet patternsbaby onesiesknit
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=11816
Cancer Ribbon Afghan Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet patterncancer ribbonafghancrochetingpatterns
https://freecuteknit.com/category/directory/page/2/
Directory Archives - Page 2 of 2 - Free Cute Knitting Patterns | How to Knit Tutorials
https://www.knitandcroshay.com/patterns
My Patterns (List) | Knit And Croshay
my patternslistknit
https://knitsewquilt.nz/knit-crochet/amigurumi/amigurumi-patterns/
Amigurumi & Macrame - Amigurumi Patterns | Knit Sew Quilt NZ
View our wonderful collection of amigurumi patterns available on our site. Browse our wide collection of cute patterns for your enjoyment. Visit our page today!
macrame patternsamigurumiknitsewquilt
https://www.ozzylosiknitdesigns.com/tag/cowl-knitting-patterns/
cowl knitting patterns Archives | OzzyLosi Knit Designs
knitting patternscowlarchivesdesigns
https://www.violetloops.com/portfolio-3/oblique-sweater---tunisian
Oblique Sweater - Tunisian | Violet Loops | Crochet & Knit Patterns
obliquesweatertunisianvioletloops
https://www.makersmercantile.com/shop/Books--Patterns/Patterns-By-Project-Type/Toys/p/Monster-Along---Knit-and-Crochet-patterns---free-pdf-pattern-download-x41514464.htm
Monster Along - Knit and Crochet patterns - free .pdf pattern download
crochet patternsfree pdfmonsteralongknit
https://www.dailycrochet.com/tag/free-crochet-patterns-for-shawls/
Free Crochet Patterns For Shawls Archives - Knit And Crochet Daily
free crochet patternsshawlsarchivesknitdaily
https://thebigknit.devonartist.co.uk/
Jo's Big Knit Website of Smoothie Hat Knitting Patterns - Jo - Big Knit
Jan 6, 2024 - Jo's Big Knit Website of Smoothie Hat Knitting Patterns, a collection of my hat patterns, and those created by other people too.
big knitjosmoothiehatknitting
https://www.benjamininternational.com/store/product21078.html
PATTERNS KNIT SOCKS
patternsknitsocks
https://www.letsknit.co.uk/free-knitting-patterns/cowl-neck-alpaca-sweater-knitting-pattern
Cowl Neck Alpaca Sweater Knitting Pattern | Knitting Patterns | Let's Knit Magazine
Cosy up in this easy, beginner-friendly stocking stitch jumper from Anniken Allis
cowl neckknitting patternalpacasweater
https://shop.lovelifeyarn.com/
Love.Life.Yarn | Modern Knit and Crochet Patterns and Workshops
Welcome to the love.life.yarn online store! We specialize in creating modern knit and crochet patterns for the whole family. Find crochet patterns, knitting...
love lifecrochet patternsyarnmodernknit
https://www.letsknit.co.uk/free-knitting-patterns/knitted-car-and-caravan-toy-set
Knitted Car and Caravan Toy Set | Knitting Patterns | Let's Knit Magazine
We're all going on a summer holiday!
https://www.crochetbeja.com/category/pattern/
Pattern - Crochet & Knit by Beja - Free Patterns, Videos + How To
Explore unique content for the Pattern category. Keep reading and searching to get inspired.
free patternscrochetknitbejavideos
https://justbcrafty.com/top-10-knit-crochet-patterns-from-2019/
Top 10 Just Be Crafty Knit & Crochet Patterns From 2019 - Just Be Crafty
just beknit crochettopcraftypatterns
https://freecuteknit.com/?link_library_category=hats-beanies-berets
Hats: Beanies & Berets Archives - Free Cute Knitting Patterns | How to Knit Tutorials
how to knit
https://marlybird.com/
Free Knit & Crochet Patterns with Video Tutorials | Marly Bird
Mar 9, 2026 - Discover patterns, tutorials, and resources for knit, crochet, and tunisian crochet from designer Marly Bird, your BiCrafty Bestie!
knit crochetwith videofreepatternstutorials
https://www.letsknit.co.uk/free-knitting-patterns/traditional-cosy-set
Traditional Tea and Egg Cosy Set With Pom-Poms! | Knitting Patterns | Let's Knit Magazine
Lerwick is a Fair Isle cosy set in pure Shetland wool, designed by Lucinda Ganderton.
https://www.generalbaileyfarm.com/listing/1067527045/knit-socks-cool-patterns-for-toasty-feet
Knit Socks: cool patterns for toasty feet free shipping offer
KNIT SOCKS! 15 Cool Patterns for Toasty Feet by Betsy Lee McCarthy. Published 2004 by Storey Publishing. Hard cover, 144 pgs. Nice table format is easy to...
feet freeknitsockscoolpatterns
https://www.letsknit.co.uk/crochet-patterns/slipper-boots-crochet-pattern
Cosy Slipper Boots Crochet Pattern | Crochet Patterns | Let's Knit Magazine
Suitable for beginner knitters, let's get comfy with Sarah Hazell's snug crocheted slipper boots.
slipper bootscrochet patterncosypatternslet
https://www.craftfreely.com/free-crochet-patterns/pattern.cfm?id=11792
Bold Blocks Afghan Free Crochet Pattern - Crocheting Patterns, Knit Patterns
Find 19,000+ Free Crochet Patterns, over 9,000 Free Knitting Patterns, and over 2,200 Free Sewing Patterns. Learn how to crochet or how to knit with our...
free crochet patternbold blocksafghancrochetingpatterns
https://www.wickedfabrics.com.au/
Sustainable and Eco Friendly Certified Knit and Woven Fabrics , Sewing Patterns and Sewing Supplies...
Discover sustainable knit fabrics and unique sewing patterns at Wicked Fabrics. Elevate your sewing projects with our eco-friendly certified collection.
eco friendlywoven fabricssewing patternssustainablecertified
https://www.letsknit.co.uk/free-knitting-patterns/magical-knitted-unicorn
Magical Knitted Unicorn | Knitting Patterns | Let's Knit Magazine
Spread a little magic with Val Pierce's unicorn playtime pal
knitting patternsmagicalknittedunicornlet
https://www.letsknit.co.uk/free-knitting-patterns/quick-knit-easter-toys-knitting-patterns
Quick Knit Easter Toys Knitting Patterns | Knitting Patterns | Let's Knit Magazine
Knit Sachiyo Ishii's spring gonks, rabbits, llama, sheep, chicken and chicks for Easter
easter toysknitting patternsquickletmagazine