https://kressmark.blogspot.com/2011/09/federation-is-fun.html
Kressmark Unified Communications: Federation is fun!
After building a short list of Swedish organizations using Lync federation, I got in contact with Julian Bee from New Zealand . Quite funny ...
unified communicationskressmarkfederationfun
https://kressmark.blogspot.com/2023/01/friends-of-microsoft-teams-week-52-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 52 - 2022 (December 26 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2018/09/microsoft-teams-news-from-ignite-2018.html
Kressmark Unified Communications: Microsoft Teams News from Ignite 2018
This week Microsoft Ignite is happening in Orlando. Five days packed with sessions, news, networking and more - and I am not there :-( but ...
unified communicationsmicrosoft teamsnews fromkressmarkignite
https://kressmark.blogspot.com/2015/01/lync-course-questions-answers-and-links.html
Kressmark Unified Communications: Lync course questions, answers and links
I have enjoyed training people on Lync 2013 for about one and a half years by now, and Lync 2010 before that. I would like to thank all my s...
unified communicationsquestions answerskressmarklynccourse
https://kressmark.blogspot.com/2020/06/
Kressmark Unified Communications: June 2020
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkjune
https://kressmark.blogspot.com/2016/11/msignite-brk2087-build-native-cloud.html
Kressmark Unified Communications: MsIgnite BRK2087 - Build native cloud apps for Skype for...
Presented by Andrew Bybee The bots are coming... The presentation started with a demo of the Smartsheet integration with presence, con...
unified communicationscloud appskressmarkmsignite
https://kressmark.blogspot.com/2021/11/ignite-2021-od103-whats-new-in.html
Kressmark Unified Communications: Ignite 2021 - OD103 - What's new in Microsoft Teams management...
Presented by: Ronit Ben Sheffer and John Gruszczyk Session summary: We will be sharing some of the latest updates across Teams management ...
what s new
https://kressmark.blogspot.com/2014/09/boken-om-it-arkitektur.html
Kressmark Unified Communications: Boken om IT-arkitektur
I have been involved in a book project that produced a very nice book which is now available, the title is "Boken om IT-arkitektur" (The IT ...
unified communicationskressmarkbokenarkitektur
https://kressmark.blogspot.com/2014/09/attendant-pro-for-lync.html
Kressmark Unified Communications: Attendant Pro for Lync
I finally got the chance to test Attendant Pro from Landis Computer. Attendant Pro is a switchboard operator / attendant application fo...
unified communicationskressmarkattendantprolync
https://kressmark.blogspot.com/2011/11/lync-cu4-one-step-closer-to-mobile.html
Kressmark Unified Communications: Lync CU4 - one step closer to mobile integration
Lync Server 2010 Hotfix KB 2493736 , aka Lync CU4 is now available for download. It contains quite a few new commands - aimed at configurin...
one step closerunified communicationskressmarklync
https://kressmark.blogspot.com/2024/07/
Kressmark Unified Communications: July 2024
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkjuly
https://kressmark.blogspot.com/2015/06/microsoft-ignite-brk3138-in-place.html
Kressmark Unified Communications: MS Ignite BRK3138 - In-place upgrade from Lync to Skype for...
As promised in my Microsoft Ignite 2015 - Sessions, Venue, Expo post, here comes another summary / review of one of the Ignite Skype for bu...
https://kressmark.blogspot.com/2019/11/ignite-2019-brk009-microsoft-teams.html
Kressmark Unified Communications: Ignite 2019 - BRK009 - Microsoft Teams
Presented by: Jared Spataro Session summary If you are tasked with transforming workplace collaboration, this session is for you!...
unified communicationskressmarkignitemicrosoftteams
https://kressmark.blogspot.com/2023/
Kressmark Unified Communications: 2023
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmark
https://kressmark.blogspot.com/2017/09/ignite-2017-demystifying-internet.html
Kressmark Unified Communications: Ignite 2017 Demystifying internet connectivity to Skype for...
On demand recording available here . Microsoft runs a high-quality network around the globe to provide services to customers. This Network ...
unified communicationsinternet connectivitykressmarkignite
https://kressmark.blogspot.com/2019/11/ignite-2019-brk3215-microsoft-teams.html
Kressmark Unified Communications: Ignite 2019 - BRK3215 - Microsoft Teams architecture update
Presented by: Bill Bliss Session summary: Join us for a deep dive into the architecture of the Teams clients and the microservices i...
unified communicationsmicrosoft teamskressmarkignitearchitecture
https://kressmark.blogspot.com/2015/04/skype-for-business-readiness-series-1115.html
Kressmark Unified Communications: Skype for Business Readiness Series (11/15)
Today I joined the eleventh session of the Skype for Business Readiness WebCast Series and the topic for today were Video Interop Server De...
skype for businessunified communicationskressmarkreadinessseries
https://kressmark.blogspot.com/2019/11/ignite-2019-brk1069-empower-your.html
Kressmark Unified Communications: Ignite 2019 - BRK1069 - Empower your Firstline workforce with...
Presented by: Keara James and Scott Morrison Session summary: From streamlining shift management to customizing the Teams experience, Micro...
unified communicationskressmarkignite
https://kressmark.blogspot.com/2024/03/friends-of-microsoft-teams-week-10-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 10 - 2024 (March 4 - March 10)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2018/09/ignite-2018-brk3232-collaborative.html
Kressmark Unified Communications: Ignite 2018 - BRK3232 - Collaborative calling and business voice...
Presented by Paul Cannon, Sr. Product Marketing Manager, Voice Anna Cao, Sr. Product Marketing Manager, Microsoft Teams both from Microsoft...
unified communicationskressmarkignite
https://kressmark.blogspot.com/2017/08/two-skype-for-business-client-fixes.html
Kressmark Unified Communications: Two Skype for business client fixes explained
The Skype for Business 2016 client is continuously being updated. This blog post will highlight two of these fixes with some graphics to sho...
skype for businessunified communicationskressmarktwoclient
https://kressmark.blogspot.com/2018/10/ignite-2018-brk3124-how-skype-for.html
Kressmark Unified Communications: Ignite 2018 - BRK3124 - How Skype for Business on-premises...
Presented by Francois Doremieux and Heidi Gloudemans This session (and the functionality) is for organizations using Lync or Skype for Busin...
skype for businessunified communications
https://kressmark.blogspot.com/2020/06/introducing-microsoft-teams-app-usage.html
Kressmark Unified Communications: Introducing the Microsoft Teams app usage report
As you might have noticed there are now more than 500 apps available for Microsoft Teams. Among popular education apps such as Assignments ...
microsoft teams appunified communicationskressmarkintroducingusage
https://kressmark.blogspot.com/2024/12/
Kressmark Unified Communications: December 2024
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkdecember
https://kressmark.blogspot.com/2016/10/fun-with-busylight-hardware.html
Kressmark Unified Communications: Fun with Busylight hardware
Back in 2012 I did a test of the Lync Busylight product, and finally it is time for a follow up. I have now received the new redesigned ver...
unified communicationsfun withkressmarkbusylighthardware
https://kressmark.blogspot.com/2019/11/ignite-2019-vce20-updates-for-direct.html
Kressmark Unified Communications: Ignite 2019 - VCE20 - Updates for Direct Routing
Presented by: Nikolay Muravlyannikov Session summary: Direct Routing allows Microsoft 365 customers to use their telecom provider and phone...
unified communicationskressmarkigniteupdatesdirect
https://kressmark.blogspot.com/2020/07/commsverse-2020-brk117-scalable-modern.html
Kressmark Unified Communications: Commsverse 2020 - BRK117 - Scalable modern teamwork model in...
Presented by: Karoliina Kettukari Session summary: How to convince your employees to move from WhatsApp and local storages to Teams? Giv...
unified communicationsmodern teamworkkressmark
https://kressmark.blogspot.com/2013/02/localized-lync-2010-training-material.html
Kressmark Unified Communications: Localized Lync 2010 Training Material
Through this Microsoft Lync 2010 Training link , you can download Lync 2010 end-user training in a Power Point format. If your end-users d...
unified communicationskressmarklocalizedlynctraining
https://kressmark.blogspot.com/2016/11/welcome-microsoft-teams.html
Kressmark Unified Communications: Welcome Microsoft Teams!
At an event in New York and online Microsoft announced Microsoft teams today. Microsoft Teams Builds on Office 365 and adds a chat-based w...
unified communicationskressmarkwelcomemicrosoftteams
https://kressmark.blogspot.com/2024/
Kressmark Unified Communications: 2024
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmark
https://kressmark.blogspot.com/2024/11/friends-of-microsoft-teams-week-46-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 46 - 2024 (November 11 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2020/09/teams-walkie-talkie-button-on-samsung.html
Kressmark Unified Communications: Teams Walkie-Talkie button on Samsung XCover Pro
Since a while back the Walkie Talkie app in Teams is in Public Preview on Android. With an Andriod phone it is possible to start the Walkie ...
unified communicationswalkie talkiesamsung xcoverkressmarkteams
https://kressmark.blogspot.com/2024/04/friends-of-microsoft-teams-week-16-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 16 - 2024 (April 15 - April 21)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2024/09/friends-of-microsoft-teams-week-35-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 35 - 2024 (August 26 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2019/11/microsoft-ignite-2019-keynote.html
Kressmark Unified Communications: Microsoft Ignite 2019 - Keynote
Satya Nadella started with welcoming and thanking the 30,000 people who made it to Ignite or was listening in remote. The keynote was about...
unified communicationsmicrosoft ignitekressmarkkeynote
https://kressmark.blogspot.com/2015/05/microsoft-ignite-2015-keynotes.html
Kressmark Unified Communications: Microsoft Ignite 2015 - keynotes
Last week I joined some 23,000 IT professionals at the McCormick Place convention center in Chicago to attend Microsoft Ignite 2015 . ...
unified communicationsmicrosoft ignitekressmarkkeynotes
https://kressmark.blogspot.com/2019/11/ignite-2019-brk3040-optimal-network.html
Kressmark Unified Communications: Ignite 2019 - BRK3040 - Optimal network connectivity for Office...
Presented by: Konstantin Ryvkin Session summary: Optimal network connectivity is critical for great user experience in Office 365. Is your ...
unified communicationsnetwork connectivitykressmarkignite
https://kressmark.blogspot.com/2019/12/ignite-2019-brk3226-every-team.html
Kressmark Unified Communications: Ignite 2019 - BRK3226 - Every team, connected: Develop Microsoft...
Presented by: Bill Bliss Session summary: The Microsoft Teams Graph APIs have grown considerably over the past year with many new APIs and t...
unified communicationskressmarkignite
https://kressmark.blogspot.com/2020/07/commsverse-2020-brk132-vision-keynote.html
Kressmark Unified Communications: Commsverse 2020 - BRK132 - Vision Keynote - The Power of...
Presented by: Jeff Teper, Laurie Pottmeyer, Geri Johnson Session summary: Community plays a big part in product development, deployment ...
unified communicationsthe powerkressmark
https://kressmark.blogspot.com/2020/10/teamsfest-2020-demo-session-microsoft.html
Kressmark Unified Communications: Teamsfest 2020 - Demo session: Microsoft Phone system for users
Presented by: Linus Cansby Session Summary: Teams is a perfect place for collaboration and one of the parts of the collaboration is voice. W...
microsoft phone systemunified communicationsdemo session
https://kressmark.blogspot.com/2019/11/ignite-2019-tms20-intelligent.html
Kressmark Unified Communications: Ignite 2019 - TMS20 - Intelligent communications in Microsoft...
Presented by: James Skay and Paul Cannon Session summary: Microsoft Teams solves the communication needs of a diverse workforce. Calling an...
unified communicationskressmarkigniteintelligentmicrosoft
https://kressmark.blogspot.com/2019/11/ignite-2019-thr2069-microsoft-teams.html
Kressmark Unified Communications: Ignite 2019 - THR2069 - Microsoft Teams: Real-world tips for...
Presented by: Tom Arbuthnot from Modality Systems Session summary: Based on real-world experience, these tips ensure your success with ...
unified communications
https://kressmark.blogspot.com/2020/10/teamsfest-2020-creating-your-champions.html
Kressmark Unified Communications: Teamsfest 2020 - Creating your Champions Quarter in Teams
Presented by: Ville Gullstrand Session Summary: Most organizations are either managing their own champions program for Microsoft 365 or loo...
unified communicationskressmark
https://kressmark.blogspot.com/2022/10/friends-of-microsoft-teams-week-43-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 43 - 2022 (October 24 - October...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2019/11/ignite-2019-vce50-contact-centers-and.html
Kressmark Unified Communications: Ignite 2019 - VCE50 - Contact centers and Microsoft Teams
Presented by: Andrew Bybee Session summary: Learn about the latest developments for Contact Center integrations to Microsoft Teams and ge...
unified communicationscontact centerskressmarkignite
https://kressmark.blogspot.com/2022/10/friends-of-microsoft-teams-week-39-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 39 - 2022 (September 26 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2019/12/ignite-2019-brk2243-drive-digital.html
Kressmark Unified Communications: Ignite 2019 - BRK2243 - Drive digital transformation using apps...
Presented by: Zakiullah Khan Mohammed Session summary: Apps in Microsoft Teams allows you to connect information, processes, people, and co...
drive digital transformationunified communicationskressmarkignite
https://kressmark.blogspot.com/2024/09/friends-of-microsoft-teams-week-38-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 38 - 2024 (September 16 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2012/10/lync-2013-visio-icons.html
Kressmark Unified Communications: Lync 2013 Visio icons
There is a new Lync 2013 Office and Exchange (and Lync)Visio stencil containing some 285 300 shapes available now. Get it here: Lync ...
unified communicationskressmarklyncvisioicons
https://kressmark.blogspot.com/2020/09/microsoft-ignite-2020-keynote.html
Kressmark Unified Communications: Microsoft Ignite 2020 - Keynote
Today Microsoft Ignite started with the keynote by Microsoft CEO Satya Nadella. Tech Intensity = (Tech adoption x Tech capability) ^ trust ...
unified communicationsmicrosoft ignitekressmarkkeynote
https://kressmark.blogspot.com/2023/03/friends-of-microsoft-teams-week-10-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 10 - 2023 (March 6 - March 12)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2023/12/friends-of-microsoft-teams-week-51-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 51 - 2023 (December 18 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2011/09/when-i-am-busy-i-am-busy-and-do-not.html
Kressmark Unified Communications: When I am busy I am busy and do not disturb me!
Lync handle the concept of busy differently than many traditional IP-PBX systems. Is it better or not? I do not personally know and I guess ...
do not disturbunified communications
https://kressmark.blogspot.com/2024/01/friends-of-microsoft-teams-week-4-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 4 - 2024 (January 22 - January...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2022/10/friends-of-microsoft-teams-week-40-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 40 - 2022 (October 3 - October...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publ...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2017/10/how-to-add-twitter-to-your-microsoft.html
Kressmark Unified Communications: How to add twitter to your Microsoft Teams channel
I am a fan of twitter and I am really happy that I now can add twitter feeds to my channels in Microsoft Teams. Would you like to do that to...
how to addunified communicationsmicrosoft teamskressmark
https://kressmark.blogspot.com/2018/11/
Kressmark Unified Communications: November 2018
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarknovember
https://kressmark.blogspot.com/2017/09/ignite-2017-plan-your-uc-refresh.html
Kressmark Unified Communications: Ignite 2017 Plan your UC refresh correctly: Skype for Business...
We will not forget our existing customers - we are investing in another refresh of Skype for business. We imagine organizations running Team...
https://kressmark.blogspot.com/2023/07/friends-of-microsoft-teams-week-29-2023_30.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 30 - 2023 (July 24 - July 30)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publ...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2025/05/
Kressmark Unified Communications: May 2025
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkmay
https://kressmark.blogspot.com/2023/06/friends-of-microsoft-teams-week-25-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 25 - 2023 (June 19 - June 25)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2016/10/msignite-brk3058-dig-into-skype.html
Kressmark Unified Communications: MsIgnite BRK3058 - Dig into the Skype Operations Framework
Presented by Bryan Nyce SOF is a framework, a set of practical application / guidance for a successful end-to-end deployment of Skype for bu...
unified communicationskressmarkmsignite
https://kressmark.blogspot.com/2024/03/friends-of-microsoft-teams-week-9-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 9 - 2024 (February 26 - March 3)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
https://kressmark.blogspot.com/2012/02/how-to-lync-enable-domain-admin.html
Kressmark Unified Communications: How to Lync enable a Domain Admin
Perhaps you have seen the error message below when trying to Lync enable a Domain Admin in the Lync control panel. Active Directory operat...
unified communicationshow tokressmarklyncenable
https://kressmark.blogspot.com/2023/11/
Kressmark Unified Communications: November 2023
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarknovember
https://kressmark.blogspot.com/2011/08/
Kressmark Unified Communications: August 2011
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkaugust
https://kressmark.blogspot.com/2023/07/friends-of-microsoft-teams-week-27-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 27 - 2023 (July 3 - July 9)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2025/02/friends-of-microsoft-teams-week-5-2025.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 5 - 2025 (January 27 - February...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2022/09/friends-of-microsoft-teams-week-37-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 37 - 2022 (September 12 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2023/02/friends-of-microsoft-teams-week-7-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 7 - 2023 (February 13 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2013/07/lync-storage-service-lyss.html
Kressmark Unified Communications: Lync Storage Service (LYSS)
Lync Storage Service (LYSS) is a storage framework in Lync Server 2013 intended to be used by different Lync Storage Service consumers for ...
unified communicationsstorage servicekressmarklynclyss
https://kressmark.blogspot.com/2016/10/
Kressmark Unified Communications: October 2016
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkoctober
https://kressmark.blogspot.com/2012/07/techeds-2012-na-eu.html
Kressmark Unified Communications: TechEDs 2012 - NA & EU
TechED 2012 in Orlando was the first TechED I attended, all-in-all a great event! Well organized, and really great to meet with all the...
unified communicationskressmarknaeu
https://kressmark.blogspot.com/2012/09/where-did-audio-selection-icon-go.html
Kressmark Unified Communications: Where did the Audio Selection icon go?
Running the Microsoft Lync courses this is an interesting bug in the Lync client that always comes up for discussion. Even if we have severa...
unified communicationsaudio selectionkressmarkicongo
https://kressmark.blogspot.com/2019/11/ignite-2019-thr1094-learn-how-to-use.html
Kressmark Unified Communications: Ignite 2019 - THR1094 - Learn how to use Shifts in Microsoft Teams
Presented by: Keara James Session summary: Discover how to create and manage shift schedules and learn about the latest mobile features in ...
learn how to use
https://kressmark.blogspot.com/2021/03/ignite-2021-get-most-out-of-microsoft.html
Kressmark Unified Communications: Ignite 2021 - Get the most out of Microsoft Teams by integrating...
https://kressmark.blogspot.com/2018/10/ignite-2018-brk3169-understanding.html
Kressmark Unified Communications: Ignite 2018 - BRK3169 - Understanding calling usage and...
Presented by Siunie Sutjahjo and Sharanya Vemu The proactive and reactive call quality monitoring toolset in Office 365 can help to improve ...
unified communicationskressmarkigniteunderstandingcalling
https://kressmark.blogspot.com/2012/01/state-of-blog-and-lync-anno-domini-2012.html
Kressmark Unified Communications: State of Blog and Lync Anno Domini 2012
I have been blogging for about a year now, and it has been fun, so I am going at it for another year. The blog had 33 posts and some 10,000 ...
unified communicationsstate ofanno dominikressmark
https://kressmark.blogspot.com/2013/02/the-great-lync-conference-of-2013.html
Kressmark Unified Communications: The great Lync Conference of 2013
I had the privilege to attend the Microsoft Lync Conference 2013 held at beautiful hotel del Coronado in San Diego! The conference s...
unified communicationsthe greatkressmarklyncconference
https://kressmark.blogspot.com/2023/05/friends-of-microsoft-teams-week-18-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 18 - 2023 (May 1 - May 7)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2017/09/ignite-2017-overview-of-microsoft-teams.html
Kressmark Unified Communications: Ignite 2017 An overview of Microsoft Teams architecture
On demand recording available here. Microsoft Teams is designed for the cloud to be agile at massive scale to amplify the value of Office 36...
unified communicationsan overviewmicrosoft teamskressmarkignite
https://kressmark.blogspot.com/2011/03/
Kressmark Unified Communications: March 2011
I'm a Microsoft Teams worker that will Skype for business and Love!
unified communicationskressmarkmarch
https://kressmark.blogspot.com/2019/11/ignite-2019-thr2130-raising-visibility.html
Kressmark Unified Communications: Ignite 2019 - THR2130 - Raising Visibility and Trust in Apps on...
Presented by: Bill Bliss Session summary: We, at Microsoft, aim to expedite adoption of Teams apps within enterprises through improved t...
https://kressmark.blogspot.com/2023/07/friends-of-microsoft-teams-week-29-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 29 - 2023 (July 17 - July 23)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publ...
microsoft teams week
https://kressmark.blogspot.com/2023/03/friends-of-microsoft-teams-week-11-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 11 - 2023 (March 13 - March 19)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2023/02/friends-of-microsoft-teams-week-8-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 8 - 2023 (February 20 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2025/06/friends-of-microsoft-teams-week-24-2025.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 24 - 2025 (June 9 - June 15)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2016/10/brk2086-plan-for-skype-for-business.html
Kressmark Unified Communications: MsIgnite BRK2086 - Plan for Skype for Business Mobile Clients
(or Enabling mobility with Skype for business) Presented by Praveen Maloo (who spoke continuously for 1 hour+ in a poised, controlled mann...
unified communicationsskype businesskressmarkmsignite
https://kressmark.blogspot.com/2013/10/swedish-spellcheck-in-lync-2013.html
Kressmark Unified Communications: Swedish Spellcheck in Lync 2013
Since we now have spellcheck in Lync from version "CU2 September 2013" (that is Lync 15.0.4535.1002 and MSO 15.0.4517.1504) the natural que...
unified communicationskressmarkswedishspellchecklync
https://kressmark.blogspot.com/2024/04/friends-of-microsoft-teams-week-17-2024.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 17 - 2024 (April 22 - April 28)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2015/12/skype-for-business-cu1-september-2015.html
Kressmark Unified Communications: Skype For Business CU1 (September 2015) fails
To make a long story short - make sure you have atleast 32 GB free disk space when running Security Updates for Skype for Business Server: S...
skype for businessunified communicationskressmarkseptemberfails
https://kressmark.blogspot.com/2019/10/a-microsoft-teams-telephone-booth.html
Kressmark Unified Communications: A Microsoft Teams telephone booth
A telephone booth, telephone kiosk, telephone call box, telephone box or public call box is a small structure furnished with a payphone an...
unified communicationsmicrosoft teamskressmarktelephonebooth
https://kressmark.blogspot.com/2025/01/friends-of-microsoft-teams-week-3-2025.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 3 - 2025 (January 13 - January...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publ...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2019/11/ignite-2019-vce10-calling-in-microsoft.html
Kressmark Unified Communications: Ignite 2019 - VCE10 - Calling in Microsoft Teams
Presented by: Paul Cannon Session summary: Learn about the basics of Calling in Teams and also get an update on the latest such as Reverse ...
unified communicationscalling inkressmarkignitemicrosoft
https://kressmark.blogspot.com/2022/12/friends-of-microsoft-teams-week-50-2022.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 50 - 2022 (December 12 -...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2023/06/friends-of-microsoft-teams-week-23-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 23 - 2023 (June 5 - June 11)
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams week
https://kressmark.blogspot.com/2023/01/friends-of-microsoft-teams-week-2-2023.html
Kressmark Unified Communications: Friends of Microsoft Teams - Week 2 - 2023 (January 9 - January...
Hello Friend of Microsoft Teams, Find below a list of public posts and updates on Microsoft Teams (and Microsoft 365) that have been publi...
microsoft teams weekunified communications
https://kressmark.blogspot.com/2020/07/commsverse-2020-brk307-analogue-to.html
Kressmark Unified Communications: Commsverse 2020 - BRK307 - Analogue to Cloud. The Challenge of...
Presented by: John Stewart-Murray Session summary: As enterprises rapidly adopt Microsoft Teams for voice and collaboration, they often unde...
unified communications
https://kressmark.blogspot.com/2017/09/msignite-2017-tk01-technology-keynote.html
Kressmark Unified Communications: MsIgnite 2017 TK01 Technology Keynote: Create a modern workplace...
It would be nice with a single app for everything we need to do, but that is not possible or practical just yet. However, Microsoft Teams ar...
unified communications
https://kressmark.blogspot.com/2011/04/psychology-in-unified-communications.html
Kressmark Unified Communications: Psychology in Unified Communications - Part I
When moving circuit based communications to digital packet based networks a large concern is bandwidth. There never seem to be enough bandwi...
unified communicationskressmarkpsychologypart