https://www.9news.com.au/national/ben-elton-comedian-backs-social-media-laws/bbbb9e6c-cf62-4549-a0c3-b62aa3af4f06
Nov 6, 2025 - Comic icon Ben Elton has vehemently supported the Albanese government's looming restrictions on social medi...
social media banben eltonlegend sayscomedymakes
https://www.outlookindia.com/sports/tennis/novak-djokovic-french-open-future-retirement-update
The 38-year-old Novak Djokovic cut an emotional figure and received a huge ovation as he left Court Philippe-Chatrier, on which he has triumphed three times...
novak djokovicfrench openfutureknow
https://www.christianpost.com/news/tennis-legend-turned-pastor-says-sport-full-of-lesbians-calls-transgenderism-work-of-the-devil-185866/
Margaret Court, an Australian tennis legend-turned-Pentecostal pastor, has stirred controversy again by claiming that the sport is "full of lesbians" and that...
tennislegendturnedpastorsays
https://www.hindustantimes.com/india/sachin-s-so-cool-says-tiger-woods-after-meeting-batting-legend/story-i6wNcKkizSIwGepvBL7cxH.html
They are legends in their own domain, but it seems iconic cricketer Sachin Tendulkar has managed to floor ace golfer Tiger Woods when the two greats caught up...
tiger woodssachincoolsaysmeeting
https://www.ksat.com/news/local/2025/08/01/san-antonio-tejano-musician-flaco-jimenez-dies-at-86-family-says/
Grammy Award-winning musical artist Flaco Jimenez has died, his family announced on his social media late Thursday night. He was 86.
san antonioflaco jimeneztejanolegenddies
https://www.fox32chicago.com/news/wwe-legend-jerry-lawler-says-he-had-a-stroke-during-sex
WWE legend Jerry 'The King' Lawler says he had a stroke while having sex with his girlfriend.
jerry lawlerwwelegendsaysstroke
https://www.wrestlinginc.com/1429000/video-wwe-samantha-irvin-says-logan-paul-not-legend-hes-not-champion/
WWE ring announcer Samantha Irvin is not a big fan of WWE star Logan Paul after their recent in-ring run-ins on WWE programming.
samantha irvinlogan paulwwesays
https://www.tastingtable.com/1035331/a-british-legend-says-this-fish-pie-saved-a-village-from-starvation/
The origins of one British fish pie are rather hazy with several conflicting stories, but one legend has it that the pie saved a village from starvation.
legend saysfish piebritishsavedvillage
https://www.foxnews.com/sports/lebron-james-no-relationship-with-lakers-legend
LeBron James and Kareem Abdul-Jabbar have had their differences in recent years, and James confirmed on Tuesday that the two have "no relationship."
lebron jamessaysrelationshiplakerslegend
https://www.gamesradar.com/the-legend-of-zelda-wes-ball-live-action-miyazaki/
My whole life has led up to this moment
legendzeldadirectorsaysmovie
https://www.tmz.com/2021/01/16/cornelius-bennett-lamar-jackson-barry-sanders-buffalo-bills-ravens-playoffs/
Enormous praise from Bills legend Cornelius Bennett -- the former Buffalo star tells TMZ Sports he believes Lamar Jackson is "the closest thing that I've seen"...
lamar jacksonclosestthingseenbarry
https://www.mirror.co.uk/partner-stories/gyokeres-can-become-emirates-hero-36264367
Former Arsenal star and NetBet main man Ray Parlour says the Swedish striker could be the difference in Sunday’s clash, providing he can shake off a...
north london derbygyokeresbecomeemirateshero
https://www.mmamania.com/2025/6/3/24442531/ufc-scripted-says-heavyweight-legend-leaks-nashville-results-july-12-fight-card-mma
Jun 3, 2025 - Derrick Lewis claims UFC is scripted and then proceeded to leak the main event results for his upcoming Nashville fight against Tallison Teixeira on July 12 in...
scriptedsaysheavyweightlegendleaks
https://www.africanews.com/2020/09/04/a-little-respect-would-be-nice-says-female-football-legend-wendie-renard-/
"We don't want to take the place of the boys or anyone else. And when we win titles, we don't want to hear "yes, it's easy for them... or it sucks," said...
little respectfemale footballwouldnicesays
https://www.globaltimes.cn/page/202601/1353256.shtml
Chinese Weiqi legend Nie Weiping, one of the most influential figures in the modern history of Weiqi, or often being referred as Go, has passed away at the age...
nie weipingweiqisagepassesaway
https://www.ruck.co.uk/all-blacks-legend-reveals-his-sons-want-to-play-for-springboks/
Jul 15, 2025 - New Zealand superstar Sonny Bill Williams has revealed his sons would prefer playing for the Springboks instead of All Blacks. The 38-year-old married South...
legend saysblackssonsaspireplay
https://www.tmz.com/2017/05/18/frankie-edgar-ufc-legend-champion/
Frankie Edgar ain't considering retirement after smashing Yair Rodriguez.
frankie edgarufclegendsayschamp
https://www.foxnews.com/entertainment/exclusive-screen-legend-angela-lansbury-says-modern-hollywood-too-manipulative
With an acting career spanning almost 70 years, Angela Lansbury is a Hollywood legend.
angela lansburyexclusivescreenlegendsays
https://hayters.com/ray-parlour-arsenal-squad-better-than-ever/
Nov 27, 2025 - Highbury Hero Ray Parlour reveals why he believes Arsenal's current squad is a match for any in the club's long hisgtory.
legend saysinvinciblearsenalstrongestsquad
https://www.sportbible.com/football/cristiano-ronaldo-man-utd-exit-rio-ferdinand-news-20221122
Manchester United have agreed to terminate Cristiano Ronaldo's contract.
manchester unitedlegend saysclubdelighted
https://www.newstalkzb.co.nz/news/entertainment/rock-legend-neil-young-says-he-will-play-glastonbury-music-festival-after-all/
Rock legend Neil Young says he will play Glastonbury music festival after all
neil youngrocklegendsaysplay
https://www.timeslive.co.za/sunday-times-daily/sport/2024-04-25-in-bafana-stars-we-trust-says-legend-buthelezi-as-sundowns-face-esperance-in-champions-league-semifinal/?device=feature_phone
Linda Buthelezi says Sundowns and their fans should go to Friday's encounter with a positive mind
bafanastarstrustsayslegend
https://www.golfdigest.com/story/adam-scott-kelly-slater-golf-surfing-pga-tour
Adam Scott and Kelly Slater have a special bond, and the golfer says he learns something from the surfing superstar every time they get together
adam scottsayswatertimesurf
https://www.foxla.com/news/hawks-legend-dominique-wilkins-said-buckhead-restaurant-turned-him-away-because-of-race
Basketball Hall of Fame player Dominique Wilkins said Le Bilboquet, a Buckhead restaurant, denied him a table because of his race. The restaurant said it was...
dominique wilkinsbuckheadrestaurantapologizeshawks