Robuta

https://www.thekitchenmagpie.com/ The Kitchen Magpie - Trusted Recipes from my Prairie Kitchen! May 9, 2026 - Best selling author and food blogger, Karlynn Johnston provides you with tried, tested and true recipes from her prairie kitchen. the kitchenmagpietrustedrecipesprairie https://www.pendle.magpiexyz.io/stake Magpie XYZ Magpie MegaDAO integrates leading DeFi protocols to optimize yield with veTokenomics, liquid Ethereum restaking, Bitcoin staking via Babylon. magpiexyz https://faenum.com/artwork/289687/magpie-on-lotus Magpie on Lotus | Public Domain Art The image depicts a square painting on a beige background with darker beige spots. The painting features a bird, flowers and leaves. The bird has a black... public domainmagpielotusart https://jessking.com.au/product-tag/magpie-birds/?product_view=list&product_orderby=price&product_count=50 Magpie birds Archives - Jess King Artist jess kingmagpiebirdsarchivesartist https://www.thekitchenmagpie.com/tag/salmon-loaf/ salmon loaf Archives - The Kitchen Magpie salmon loafthe kitchenarchivesmagpie https://glendabrooks.blogspot.com/2013/12/december-heartfelt-creations-alumni.html?showComment=1388770612655 MagPie's Corner : December Heartfelt Creations Alumni Design Team Blog Hop Good morning everyone and welcome to the December Heartfelt Creations Alumni Design Team Blog Hop! Boy is that a mouthful! Now get ready ... heartfelt creationsdesign teammagpiecornerdecember https://www.knitmoregirlspodcast.com/2018/06/magpie-episode-484-knitmore-girls.html The Knitmore Girls Podcast: Magpie - Episode 484 - The Knitmore Girls Listen here: This week's episode is sponsored by: We dreamed of a time when yarn would feed smoothly so that we could knit row... girlspodcastmagpieepisode https://www.magpiediamondart.com/product/silicon-multiplacer-pens-with-wheel/S5O2A7RPNIKZNZAK742ECP7B Magpie Diamond Art magpiediamondart https://www.magpieartsllc.com/shop/fantasy/WWNK2S4XNIAJNGCWSLIKWMWG Magpie Arts LLC magpieartsllc https://talkingmagpie.co.uk/2025/09/30/ 30.09.2025 - Talking Magpie talkingmagpie https://magpiesmumblings.blogspot.com/2014/08/something-that-tugs-at-heart-strings.html MAGPIE'S MUMBLINGS magpiemumblings https://www.graemechapman.com.au/library/viewphotos.php?c=324&pg=2 Magpie-lark - Australian Birds - photographs by Graeme Chapman Photos of Magpie-lark by Graeme Chapman. australian birdsmagpielarkphotographsgraeme https://www.saascounter.com/products/magpie-property-management Magpie Property Management Pricing, Features & More 2026 | SaaSCounter With the help of SaaSCounter, learn about Magpie Property Management - features, pricing, and discover how it can benefit your business. Get free demos today! property management pricingmagpiefeatures https://magpiesmumblings.blogspot.com/2023/02/a-teeny-little-finish.html MAGPIE'S MUMBLINGS: A teeny little finish Some of you may remember I shared a link to making a Lego-themed tissue box cover and I simply couldn't resist making one for my oldest gra... magpiemumblingsteenylittlefinish https://magpieecotourism.com/category/biracial-dating-real-singles-site-2/ MAGPIE GROUP Biracial Dating real singles site Chopta is the commencement point of the trek to Tungnath -3rd Kedar. Another 1.5 km trek from Tungnath leads to Chandrashila(4000mts above the sea level) which... magpiegroupbiracialdatingreal https://www.shikshatam.com/institute/magpie-academy-raja-park-jaipur Magpie Academy 301, 3rd Floor, Pratap, 244-245, Dhruv Marg, near Baskin-Robbins, Tilak Nagar, Raja... If you are looking for the best COMPUTER CLASSES near you, then you are at the right place. Students of Year 1, Year 2, Year 3, Year 4, Graduate, Post... https://plackittandbooth.co.uk/product/magpie-murders-the-book-of-the-major-hit-bbc-series-magpie-murders-from-the-sunday-times-bestselling-author/ Magpie Murders : The book of the major hit BBC series Magpie Murders from the Sunday Times... Apr 28, 2026 - Author: Horowitz, Anthony Published 13/06/2017 | Paperback / softback129 x 196 x 35 | 394g magpie murdersthe book https://magpieartistry.com/ Chinese Teaching & Art Portfolio | Magpie Artistry Explore my unique portfolio that combines my updated Chinese teaching skills with my artistic creations. This isn't just an art portfolio; it showcases my... teaching artchineseportfoliomagpieartistry https://www.magpiewedding.com/tag/british-wedding-dress/ british wedding dress Archives - Magpie Wedding british weddingdressarchivesmagpie https://glendabrooks.blogspot.com/2011/05/happy-monday-morning.html MagPie's Corner : A Happy Monday Morning...... Good Monday everyone.....I know I sound so cheerful for it to be Monday, but that is how I feel. Life is good. This morning I want to sh... happy mondaymagpiecornermorning https://glendabrooks.blogspot.com/2015/10/woyww-331.html MagPie's Corner : WOYWW #331 Good morning friends! Wednesday has rolled around again and it is time to show you what is on my workdesk this morning! If you are interes... magpiecorner https://itistimetothinkformyself.blogspot.com/2010/10/magpie-37-mirrors-reflections.html?showComment=1287712085267 Summer Rain at Mountain View or Silicon Valley: Magpie #37-Mirrors, Reflections! Waterfall, down it pours, Force that resembles loss. Attractions, traveling tours, Experiences that marks down growth. . ^ ^ Raindrops, tea... summer rainmountain view https://www.magpieartsllc.com/product/pc-72-fire-ice/HVP6KTXBLJSXNA4BJTP2RYRV Magpie Arts LLC magpieartsllc https://www.magpiewedding.com/tag/swing-band/ swing band Archives - Magpie Wedding swing bandarchivesmagpiewedding https://magpieecotourism.com/category/paydayloan4less-com-payday-loans-online-same-day-2/ MAGPIE GROUP paydayloan4less.com payday loans online same day Chopta is the commencement point of the trek to Tungnath -3rd Kedar. Another 1.5 km trek from Tungnath leads to Chandrashila(4000mts above the sea level) which... payday loans onlinemagpiegroup https://www.magpiehollow.farm/p/climbing-mt-katahdin Climbing Mt Katahdin - Magpie Hollow Farm News but not in the way you think climbingmtkatahdinmagpiehollow https://www.heylittlemagpie.com/offers/ Offers - Hey Little Magpie offersheylittlemagpie https://www.magpieblossoms.com/product-page/3-oz-chocolate-green-dinner-mints 3 oz Chocolate & Green Dinner Mints | Magpie Look out Chocolate Lovers! We have taken our famous green and white pastel mint and sandwiched it between layers of milk chocolate with pure peppermint oil.... ozchocolategreendinnermints https://magpiebooks.ca/item/H4Xn4e03TBlAhThVEYH4hQ Agnes Lives! by Hallie Elizabeth Newton | Magpie Books "An astonishing debut as mesmerizing as it is unnerving." --Joyce Carol OatesA day-in-the-life debut novel about a fading socialite on the hunt for someone to... agnesliveshallieelizabethnewton https://www.penguinthemagpie.com/product/frankie-5/ FRANKIE 5 – Penguin the Magpie frankiepenguinmagpie https://magpie-inn.com/ Chef Owned and Operated Inn Downtown Mineral Wells, TX | Magpie Inn Jan 29, 2026 - Magpie Inn is a beautiful chef owned and operated boutique inn located in the heart of downtown Mineral Wells. mineral wellschefownedoperatedinn https://lifeformsart.co.uk/celebrating-nature/corvid-id/attachment/magpie/ Magpie - Lifeforms Art magpielifeformsart https://magpiegames.com/ Magpie Games Magpie Games publishes award-winning tabletop roleplaying games like Avatar Legends, Root: The RPG, Masks, and Urban Shadows. Our story-rich, player-driven... magpiegames https://livornodailyphoto.blogspot.com/2015/12/a-magpie.html?showComment=1449580430069 Livorno Daily Photo: A Magpie I caught this magpie in Via Montebello last Sunday. Search labels: bird Versione italiana daily photolivornomagpie https://puriture.com/modern-magpie-bird-led-table-lamp/ Modern Magpie Bird LED Table Lamp modernmagpiebirdledtable https://hbsaccess.co.uk/solar-panel-cleaning-magpie-green/ Solar Panel Cleaning Magpie Green - hbsaccess.co.uk Home Solar Panel Cleaning Based in Magpie Green At HBS Access, we provide professional solar panel cleaning services across Magpie Green and the surrounding... solar panel cleaningmagpiegreencouk https://www.magpieandtigervt.com/product/portable-flower-press/6UHLNSWWPFB43YVD7JWRMMYX Magpie & Tiger magpietiger https://magpiefiles.blogspot.com/2008/11/fireworks-fudge.html The Magpie Files: Fireworks Fudge Last year I wrote about a fudge recipe which we make every year in memory of a much loved family friend, Sue Rundell. This year I offer you... magpiefilesfireworksfudge https://www.nugs.net/live-download-of-the-magpie-salute-the-peach-music-festival-scranton-pa-08-11-2017-mp3-flac-or-online-music-streaming/18603.html The Magpie Salute Live Concert Setlist at The Peach Music Festival, Scranton, PA on 08-11-2017 The Magpie Salute live downloads and online music streaming of 08/11/2017 at The Peach Music Festival Scranton, PA. Listen to live concerts at nugs.net or... https://www.heylittlemagpie.com/brands/49-market/?add-to-cart=141724 49 & Market - Hey Little Magpie marketheylittlemagpie https://www.thekitchenmagpie.com/mushroom-crockpot-cube-steak-gravy/ Mushroom Crock Pot Cube Steak & Gravy - The Kitchen Magpie crock potthe kitchenmushroomcubesteak https://www.heylittlemagpie.com/product/brands/arden-creative-studio/katie-pertiet-been-there/arden-creative-studio-katie-pertiet-been-there-epoxy-stickers/?add-to-cart=85205 Arden Creative Studio - Katie Pertiet Been There - Epoxy Stickers - Hey Little Magpie May 8, 2026 - Add the perfect finishing touch to your Been There projects with these coordinating epoxy stickers by Katie Pertiet. This single sheet includes 158... arden creative studiobeen there https://talkingmagpie.co.uk/2026/03/27/ 27.03.2026 - Talking Magpie talkingmagpie https://www.magpieknits.com/the-collection-needlepoint-pillows.html THE COLLECTION Needlepoint Pillows - Magpie Knits This fun needlepoint canvas is designed by Lizzie Clark and is on 13 mesh canvas and is 10in x 10in. the collectionneedlepoint pillowsmagpieknits https://magpieandoldlead.blogspot.com/2015/01/wyrm-emerges.html Magpie and Old Lead: Wyrm Emerges But see, amid the mimic rout, A crawling shape intrude! A blood-red thing that writhes from out The scenic solitude! It writhes! -it wri... and oldmagpielead https://www.magpie.org/vision/lauren-tate/ Lauren Tate | Magpie laurentatemagpie https://cinemaos.me/movie/974292 Magpie (2024) - Cinemaos A couple's lives are thrown into disarray when their daughter is cast opposite a controversial major star. magpiecinemaos https://magpieecotourism.com/category/black-hookup-apps-top10-2/ MAGPIE GROUP black hookup apps top10 Chopta is the commencement point of the trek to Tungnath -3rd Kedar. Another 1.5 km trek from Tungnath leads to Chandrashila(4000mts above the sea level) which... black hookup appsmagpiegroup https://www.visitbluffton.org/pottery-studio-magpie-ceramics The Pottery Studio by Magpie Ceramics | Bluffton Hotel the pottery studiomagpieceramicsblufftonhotel https://magpie.im/ Welcome to Magpie Magpie is the premier digital payments platform in the Philippines. welcome tomagpie https://glendabrooks.blogspot.com/2014/09/sunflowers.html?showComment=1411256055304 MagPie's Corner : Sunflowers I love sunflowers and sometimes grow them in a row in my garden. This year my neighbor had some growing in a flower bed and she expressed t... magpiecornersunflowers https://magpiesmumblings.blogspot.com/2011/01/more-evidence-of-progress.html MAGPIE'S MUMBLINGS: More evidence of progress 3 bundles, each about 2" thick, of assorted craft patterns!! These are destined for a massive yard sale in the spring. I always find it... magpiemumblingsevidenceprogress https://www.thekitchenmagpie.com/10-crowd-pleasing-side-dish-recipes-for-the-4th-of-july/ 10 Crowd-Pleasing Side Dish Recipes For the 4th of July - The Kitchen Magpie Jul 3, 2025 - This roundup consists of 10 recipes that everyone will love at your 4th of July BBQ. Mom's Potato Salad Image Credit: Mom's Potato Salad - The Kitchen side dish recipes https://itistimetothinkformyself.blogspot.com/2010/10/magpie-37-mirrors-reflections.html?showComment=1288007167496 Summer Rain at Mountain View or Silicon Valley: Magpie #37-Mirrors, Reflections! Waterfall, down it pours, Force that resembles loss. Attractions, traveling tours, Experiences that marks down growth. . ^ ^ Raindrops, tea... summer rainmountain view https://magpiefiles.blogspot.com/2009/01/standing-at-cliff-edge.html The Magpie Files: Standing at the cliff edge I have been so grateful for your kind, thoughtful comments over the past two weeks. It made me wonder anew at the power of blogging. Each on... magpiefilesstandingcliffedge https://www.distinctlymontana.com/comment/6742 The Old Broke Rancher on Why the Magpie is Better than the Meadowlark The magpie is a bird that would probably wear a cool leather jacket if they had arms to put in the sleeves. Their diet consists of whatever they can find, from... the old broke rancherbetter than https://www.thekitchenmagpie.com/houstons-nightly-spirits-historic-haunted-pub-tours/ Houston's Nightly Spirits Historic Haunted Pub Tours - The Kitchen Magpie Jun 1, 2020 - Houston's Nightly Spirits Historic Haunted Pub Tours! If you are looking for a ghostly night out in Houston with "spirits", this is the tour for you! pub toursthe kitchenhoustonnightlyspirits https://www.mullingmagpie.com/who-we-serve Magpie Solutions | Who We Serve | Business Consulting Magpie Solutions is a business consulting firm that primarily serves organizations that focus on social and emotional learning and mental health and wellness. who we servemagpiesolutionsbusinessconsulting https://www.magpiepieces.shop/product/6268103/oorbellen-clustered-bobs Oorbellen "clustered Bobs" | Magpie Pieces Materialen: glas. Gemaakt op RVS, dus nikkelvrij en kleurvast. Kleuren: rood, geel, groen. Zoektermen: rasta. oorbellenclusteredbobsmagpiepieces https://www.magpiewedding.com/tag/bright-styling/ bright styling Archives - Magpie Wedding brightstylingarchivesmagpiewedding https://www.highlanderbarmt.com/event-details/live-music-by-phatt-lipp Live Music by Phatt Lipp | Magpie Creek Ranch Phatt Lipp puts a fresh spin on an eclectic mix of tunes, weaving together country charm, classic rock grit, folk soul, and modern pop flair. From Johnny Cash... live musicmagpiecreekranch https://magpieecotourism.com/category/married-secrets-review-2/ MAGPIE GROUP Married Secrets review Chopta is the commencement point of the trek to Tungnath -3rd Kedar. Another 1.5 km trek from Tungnath leads to Chandrashila(4000mts above the sea level) which... married secretsmagpiegroupreview https://magpiebooks.ca/item/7gkUDaU43PgkIRaEqsidiw House of Idyll by Delilah S Dawson | Magpie Books From the New York Times bestselling author of Bloom and Guillotine comes a darkly seductive tale of beautiful rock stars, sinister cults, and a magical oasis... delilah s dawsonhouse ofidyllmagpiebooks https://missmagpiemusings.blogspot.com/2013/01/a-pretty-good-start.html Miss Magpie's musings: A Pretty Good Start. Today began with a generous glass of Buck's Fizz while lounging in bed reading, if this is a sign of how 2013 is going to shape up then I'm ... miss magpiepretty goodmusingsstart https://ladymagpie.com/ Lady Magpie ladymagpie https://www.wingedhearts.org/comment/95 Magpie Inheritance | WingedHearts.org magpieinheritance https://www.twelfthmagpie.com/2026/03/20/how-much-will-you-need-in-a-sipp-to-earn-a-3k-monthly-passive-income-in-2053/ How much will you need in a SIPP to earn a £3k monthly passive income in 2053? | The Twelfth Magpie A SIPP can be an exceptional wealth-building tool. Royston Wild explains how -- and reveals a top FTSE 100 dividend stock to consider for one. https://magpiesmumblings.blogspot.com/2007/08/more-experiments-and-further-on-ms.html MAGPIE'S MUMBLINGS: More experiments Now, as for today's pictures - I've been experimenting again, using a technique I found on http://ko-ok.blogspot.com I'm not at all sur... magpiemumblingsexperiments https://gov.magpiexyz.io/c/magpie/12 Latest Magpie topics - Magpie XYZ latestmagpietopicsxyz https://gravworks.com/magpie-cottage/view/new-member/ New Member - Magpie Cottage new membermagpiecottage https://glendabrooks.blogspot.com/2014/11/woyww-286.html?showComment=1417040228756 MagPie's Corner : WOYWW # 286 Good morning everyone and welcome to What's on Your Workdesk? Wednesday #286. Every Wednesday we get together and take a photo of our space ... magpiecorner https://www.thekitchenmagpie.com/tag/strawberry-milk/ strawberry milk Archives - The Kitchen Magpie strawberry milkthe kitchenarchivesmagpie https://magpiefiles.blogspot.com/2008/04/masterm-and-oak-tree.html The Magpie Files: MasterM and the Oak Tree MasterM inspects his oak tree . The buds are spilling open, fresh spring leaves. I have successfully nurtured it for another year. MasterM r... magpiefilesoaktree https://www.magpieknits.com/brands/comma-craft/?source=facebook Comma Craft - Magpie Knits Magpie Knits sells exquisite yarns and needlepoint and hand made gifts. commacraftmagpieknits https://gypsymagpie.com/tag/miss-mustard-seed/ miss mustard seed Archives | Gypsy Magpie miss mustard seedarchivesgypsymagpie https://magpieexpress.com/ Magpie Express | Buy Unlimited express buymagpieunlimited https://livornodailyphoto.blogspot.com/2015/12/a-magpie.html?showComment=1449593356434 Livorno Daily Photo: A Magpie I caught this magpie in Via Montebello last Sunday. Search labels: bird Versione italiana daily photolivornomagpie https://firsttumblewords.blogspot.com/2011/06/haiku-for-magpie-tales.html?showComment=1307414550093 Tumblewords: Haiku for Magpie Tales Tess Kincaid of Magpie Tales offers an enigmatic image as a weekly prompt to draw words from writers. This is #68. light blinded da... tumblewordshaikumagpietales https://www.thekitchenmagpie.com/recipes/breakfast-brunch/page/2/ Breakfast & Brunch - Page 2 of 9 - The Kitchen Magpie breakfast brunchthe kitchenmagpie https://www.magpiegemstones.com/ Wholesale, Retail, High Quality Gemstone Beads - Magpie Gemstones Premium quality gemstone beads. Free fast shipping and a 100% guarantee, retail, wholesale. ~Great Beads for Great People~ wholesale retailhigh qualitygemstone beadsmagpiegemstones https://www.atomretro.com/magpie-hornsea-pottery-birds-stoneware-mug Magpie x Hornsea Pottery Retro 70s Birds Mug in Chartreuse Green A fab retro gift idea, the Magpie x Hornsea Pottery Birds Mug in chartreuse. Vintage 70s inspired stoneware design perfectly presented in matching box magpiexhornseapotteryretro https://magpiefiles.blogspot.com/2008/11/happy-birthday-missm.html?showComment=1226630160000 The Magpie Files: Happy Birthday MissM MissM was the cutest baby ever. She was so small that all her baby clothes were too big and we had to buy special, doll-sized outfits. She w... happy birthdaymagpiefiles https://www.magpievalves.com/common-sealing-forms-of-industrial-valves.html Common Sealing Forms of Industrial Valves | Magpie This article explains common valve sealing methods, including butterfly valve seat seals, flange sealing types, and self-tightening body-bonnet flange seals. industrial valvescommonsealingformsmagpie https://magpiesmumblings.blogspot.com/2024/01/happy-new-year.html MAGPIE'S MUMBLINGS: Happy New Year! HAPPY NEW YEAR! May the New Year bring you peace, success, and the strength to overcome any challenges that come your way and as Ralph Wald... magpiemumblingshappynewyear https://www.magpiewedding.com/tag/elegant-wedding-dresses/ elegant wedding dresses Archives - Magpie Wedding elegant wedding dressesarchivesmagpie https://www.nfk.com.au/24_dash_YMT/Magpie-Yellow-Masking-Tape%2C-50-Mtr-Length/pd.php Magpie Yellow Masking Tape, 50 Mtr Length - NFK The Waterproof and Heat-Resistant Masking Tape | Yellow Masking Tape | General Purpose Masking Tape 63 gsm yellow saturated crepe paper... masking tapemagpieyellowmtrlength https://gypsymagpie.com/tag/love/ love Archives | Gypsy Magpie lovearchivesgypsymagpie https://www.englishbooks.com.tr/2023/11/the-magpie-and-milk.html The Magpie and the Milk by Rachel Bladon | Classic Tales | Level 1 English book, Audiobooks,Classic Tales,Level 1,Rachel Bladon,Oxford Publishing,The Magpie and the Milk,Kids Book, classic talesmagpiemilk https://glendabrooks.blogspot.com/2014/09/sunflowers.html?showComment=1411212149420 MagPie's Corner : Sunflowers I love sunflowers and sometimes grow them in a row in my garden. This year my neighbor had some growing in a flower bed and she expressed t... magpiecornersunflowers https://www.thekitchenmagpie.com/tag/black-beans/ black beans Archives - The Kitchen Magpie Are you looking for black beans recipes? Look no further! This is our full list of all items tagged with the term black beans. black beansthe kitchenarchivesmagpie https://aussiemagpie.blogspot.com/2012/10/who-creates-wealth-iv.html Magpie's Asymmetric Warfare: Who Creates Wealth? (IV) In a previous post in this series we've seen that shareholders in general do not contribute to the firms they own. Yet, they gain from it. ... asymmetric warfaremagpiecreateswealthiv https://www.thesoundcheck.com.au/post/australian-music-week-feature-magpie-diaries AUSTRALIAN MUSIC WEEK FEATURE: Magpie Diaries Jun 26, 2023 - With over 150 acts from every corner of the musical realm lined up to take over Cronulla's local venues, there's something for everyone at this year's event. An australian musicweekfeaturemagpiediaries https://www.magpievalves.com/forged-steel-check-valve/P2.html Page 2 of Forged Steel Check Valve Manufacturer from China | Magpie forged steel check valvefrom china https://ec2-3-104-144-36.ap-southeast-2.compute.amazonaws.com/news/2023/08/18/former-magpie-honoured/ Former Magpie honoured | Fleurieu Sun Aug 18, 2023 - On August 15, a commemoration was held for the life and achievements of former Port Adelaide Magpies player and Estia [...] formermagpiefleurieusun https://www.pretty-magpie.com/product-page/moon-and-stars-stackable-headband Moon and Stars Stackable Headband | Pretty Magpie With their comfortable fit and timeless designs, our Pretty Magpie headbands are a perfect addition to your accessory collection. Whether you're attending a... moon and starsstackableheadbandprettymagpie https://magpiefiles.blogspot.com/2008/05/goats-cheese-and-spinach-flamme.html?showComment=1211198400000 The Magpie Files: Goats' Cheese and Spinach Flamme I am not going to pretend that I made this: It has been a busy week with lots of driving, shirts to be ironed for formal events a late night... goats cheesemagpiefilesspinachflamme https://www.magpieboise.com/product/one-year-membership-2-children/TMV4ATAK76YDK3AA5E27BTMY Magpie Play Cafe magpieplaycafe https://glendabrooks.blogspot.com/2014/11/my-christmas-ornaments.html?showComment=1417210925817 MagPie's Corner : My Christmas Ornaments Good morning everyone. I'm hiding out here at home today to avoid the beginning of the mad rush to Christmas! No way would I be caught out... magpiecornerchristmasornaments https://magpiesmumblings.blogspot.com/2007/11/best-laid-plans.html MAGPIE'S MUMBLINGS: The best laid plans... ....are bound to run amuck! Can someone please explain to me how one person can manage to ignore the fact that there's a 'certain' day in De... the bestmagpiemumblingslaidplans https://magpiesmumblings.blogspot.com/2008/01/3000-i-think-not.html MAGPIE'S MUMBLINGS: $3000??? I think not!!! Warning: Mumble (and bitch) ahead. Take appropriate precautions. We both had dentist appointments today. After sixteen xrays (yeah, 16 - y... i thinkmagpiemumblings