Robuta

https://blog.papertreyink.com/2018/02/make-it-monday-312-framing-sentiments-images/ Make it Monday #312: Framing Sentiments & Images make it mondayframingsentimentsimages https://ppp-makeitmonday.blogspot.com/2011/12/make-it-monday-66-with-my-mums-crafts.html?showComment=1323173007341 Make It Monday: Make It Monday #66 with My Mum's Crafts Shop Hello MIM fans! It's Monday which means a new linky Party! Another fab week of creativity from you all and from your feedback it sounds li... make it mondaymy mums craftsshop https://chrissyscardland.blogspot.com/2012/09/make-it-mondayagain.html?showComment=1346799067757 Chrissyscardland : Make it Monday...Again Hello Everyone....hope you all had, or are still having a great weekend..mine unfortunately is over,and Monday morning is here, so back to... make it monday https://chezparmentier.blogspot.com/2013/08/pti-make-it-monday-128-random.html?showComment=1375740908403 Chez Parmentier: PTI Make it Monday #128 random background stamping Papier, Stempels, Mooie teksten, Kleur en Inspiratie. pti make it mondaychez parmentierrandombackgroundstamping https://ppp-makeitmonday.blogspot.com/2011/11/make-it-monday-63.html?showComment=1321403195347&m=0 Make It Monday: Make It Monday #63 Hello MIM fans I hope you have all had a wonderful week and found some time for crafting. The team and I have had a whole heap of fun chec... make it monday https://christinamaclaren.blogspot.com/2011/03/tuesday-trigger-button-make-it-monday-6.html?showComment=1301352449418 SeaGlass Papercrafts: Tuesday Trigger: Button & Make it Monday #6 Evening, folks! As promised, I'm back with a card tonight. This one was inspired by this week's Tuesday Trigger over at Moxie Fab World ,... make it mondaytuesday triggerseaglasspapercraftsbutton https://savegreenbeinggreen.blogspot.com/2013/01/make-it-monday-slow-cooker-white-chili.html Save Green Being Green: Make It Monday: Slow Cooker White Chili Recipe Have I ever mentioned that I love cooking in the slow cooker? I do. It is wonderful to be able to prepare something ahead of time and let it... make it mondayslow cookersavegreen https://savegreenbeinggreen.blogspot.com/2012/12/make-it-monday-christmas-pancakes.html Save Green Being Green: Make It Monday: Christmas Pancakes Here are just some ideas for some Christmas pancakes that I made my family. We had snowflake sprinkles so I added them to the plates for ... make it mondaysavegreenchristmaspancakes https://ppp-makeitmonday.blogspot.com/2014/03/announcing-final-mim-winner.html?showComment=1395021930524 Make It Monday: Announcing the final MIM winner Hi MIM friends. Oh my you lot made me cry this week! Thank you so much for your wonderful comments. What a lovely community this ... make it mondaythe finalannouncingmimwinner https://michelle-pinkpaperparadise.blogspot.com/2011/06/make-it-monday-41.html?showComment=1308061011288 Pink Paper Paradise: Make It Monday #41 Hello my wonderful blogging buddies!! I hope you have all had a fabulous weekend and are feeling refreshed and rejuvinated, ready for the w... make it mondaypink paperparadise https://craftingwhileiwait.blogspot.com/2016/09/pti-make-it-monday-black-and-white-to.html?showComment=1473639219795 Crafting While I Wait: PTI Make-It Monday ~ Black and White To Color pti make it monday https://lalkygirl-my-creative-place.blogspot.com/2012/07/make-it-monday-linky-time-again.html My creative Place: Make it monday linky time again!!! It is monday so that means the new linky party is open for Make it Monday ...so this week we are sponsored by the digi doodle shop so the... make it mondaymy creativeplacelinkytime https://leighpenner.blogspot.com/2018/05/make-it-monday-321-card-concept-92.html?showComment=1525655918293 TO THE FULL: Make It Monday #321 & The Card Concept #92 Hi there! I'm popping in this afternoon to share a card that I made for this week's Make It Monday at Papertrey Ink: Ink Blending on Co... make it mondayto thecard conceptfull https://chezparmentier.blogspot.com/2014/12/pti-make-it-monday-191-glittered-frames.html?showComment=1417894841054 Chez Parmentier: PTI Make it Monday #191 glittered frames Papier, Stempels, Mooie teksten, Kleur en Inspiratie. pti make it mondaychez parmentierglitteredframes https://scrappietoo.blogspot.com/2013/09/make-it-monday-132-layered-border-die.html?showComment=1379782289056 Make it monday # 132 layered border die cuts. Lucky me I won the make it monday # 131 , so I have to shop I think. How bad is that, wink, wink....... Jippie ik heb de vorige make it mon... make it mondaylayeredborderdiecuts https://collettaskitchensink.blogspot.com/2016/02/make-it-monday-grandmas-heart-square.html Colletta's Kitchen Sink: Make It Monday ~ Grandma's Heart Square ~ 2/8/16 The BAMCAL 2016 February Main Square is called " Grandma's Heart ". This is the first time I've tried a square with a heart in it s... make it monday https://chezparmentier.blogspot.com/2013/10/pti-make-it-monday-135-layered-emboss.html?showComment=1381672790288 Chez Parmentier: PTI Make it Monday #135 - layered emboss resist Papier, Stempels, Mooie teksten, Kleur en Inspiratie. pti make it mondaychez parmentierlayeredembossresist https://cupcakescardsandkim.blogspot.com/2017/08/papertrey-ink-make-it-monday-293-color.html Cupcakes, Cards and Kim: Papertrey Ink Make It Monday #293 - Color Slider Card Hello...popping in my version of a magic slider card for this week's Make It Monday at PTI . I don't have many stamps from PTI that ar... make it monday https://ppp-makeitmonday.blogspot.com/2012/07/make-it-monday-99-with-digi-my-world.html?showComment=1344433622648&m=0 Make It Monday: Make It Monday #99 with Digi My World Well hello MIM fans!! Wow, seriously, what an amazing week last week, over 300 entries which is our biggest week ever! Thank you to... make it mondaydigiworld https://michelle-pinkpaperparadise.blogspot.com/2012/04/make-it-monday-83-with-cupcake-cards.html?showComment=1333332645500 Pink Paper Paradise: Make It Monday #83 with Cupcake Cards & Craft Hi, nice to see you here. Welcome to my new followers this week. I started off the year well, sticking to my new year's resolution to... make it mondaypink paperparadise https://ppp-makeitmonday.blogspot.com/2011/11/make-it-monday-65-blogger-trouble.html?m=0 Make It Monday: Make It Monday #65 - Blogger trouble Hi MIM Fans We seem to be experiencing some Blogger problems at the moment. Here is the link (hopefully) for this week's linky party. ... make it mondaybloggertrouble https://ppp-makeitmonday.blogspot.com/2012/08/mim-102-with-digi-doodle-shop.html?showComment=1345060994196 Make It Monday: MIM #102 with Digi Doodle Shop Hi MIM fans! Here we are again, time for a brand new linky party. We had so much fun last week, I hope you all got to check out plen... make it mondaydigi doodlemimshop https://chrissyscardland.blogspot.com/2011/10/make-it-monday-starts-again.html?showComment=1320029176214 Chrissyscardland : Make it Monday starts again Hello Everyone, Another week is starting, and MAKE IT MONDAY is away again... What a fabulous amount of gorgeous projects last week.... make it mondaystarts https://michelle-pinkpaperparadise.blogspot.com/2012/04/make-it-monday-83-with-cupcake-cards.html?showComment=1333332922546 Pink Paper Paradise: Make It Monday #83 with Cupcake Cards & Craft Hi, nice to see you here. Welcome to my new followers this week. I started off the year well, sticking to my new year's resolution to... make it mondaypink paperparadise https://distresseddonnadownhome.blogspot.com/2014/12/make-it-monday-15.html Distressed Donna Down Home: Make It Monday #15 Welcome to another Make It Monday We want to see your creative projects, delicious recipes, furniture transformations, and thrifty ... make it mondaydonna downdistressed https://ppp-makeitmonday.blogspot.com/2012/07/mim-100-with-scrapbook-sisters.html?showComment=1343987425133&m=0 Make It Monday: MIM #100 with Scrapbook Sisters Hello MIM fans and welcome to a very special 100th Make It Monday linky Party I can hardly believe we are at 100 already, what an ama... make it mondaymimscrapbooksisters https://karenskreativekards.blogspot.com/2011/06/make-it-monday-and-hooked-on-crafts.html Karen's Kreative Kards: Make it Monday and Hooked On Crafts Challenges Anything Goes is the theme of the challenges at Make It Mondays and at Hooked on Crafts and that is my favorite kind of challenge. I am ent... make it monday https://savegreenbeinggreen.blogspot.com/2014/03/make-it-monday-oat-pumpkin-bread.html?showComment=1395087732883 Save Green Being Green: Make It Monday: Oat Pumpkin Bread I admit that I started experimenting and came up with the recipe because I was out of whole wheat flour and noticed I had 1 1/2 bags of ... make it mondaysavegreenoatpumpkin https://ppp-makeitmonday.blogspot.com/2013/01/mim-125-with-meljens-designs.html?showComment=1359430929501&m=0 Make It Monday: MIM #125 with Meljen's Designs Hi MIM friends So sorry to be so late getting this linky party started!! I live in Queensland, Australia and for the last week we h... make it mondaymimmeljendesigns https://ppp-makeitmonday.blogspot.com/2012/10/mim-111-with-meljens-designs.html?showComment=1350400487435&m=0 Make It Monday: MIM #111 with Meljens Designs Hi MIM fans!! Wow, I feel like I have been gone forever!! The absolutely, positively AWESOME MIM Design Team have been looking a... make it mondaymimmeljensdesigns https://aschoss.blogspot.com/2009/04/monday-mini.html Anya - Life is What You Make It: Monday Mini Hi everyone! I hope you had a great weekend - we were busy, busy. Saturday was an absolutely gorgeous day and we spent it celebrating birt... life is what you make itanyamondaymini https://linscraftcorner-linda.blogspot.com/2015/06/make-it-monday-213-with-betsy-cool.html?showComment=1433222157700 Lin's Craft Corner: Make It Monday #213 with Betsy - Cool Condensation Effects So hard to see the dew drops in the first picture so decided I needed a close up. A card for MIM Click on MIM to watch the v... make it monday https://jacquiesouthas.blogspot.com/2012/10/make-it-monday-86-inside-edition.html What did I do today?: Make It Monday #86 - The Inside Edition The challenge for Papertrey Ink's Make It Monday this week is to finish the inside of your card with stamping. Details are on Nichole Heady'... make it monday https://chrilvian.blogspot.com/2014/08/make-it-monday-make-butterflyccdesignsr.html CHRILVIAN: Make It Monday: Make a butterfly(CCDesignsrubberstampsDTpost) Hallo volgers, Het is vandaag Make it Monday bij CCDesignsrubberstamps en het is mijn beurt vandaag. Vandaag laat ik jull... make it mondaychrilvianbutterfly https://handmade-little-things.blogspot.com/2013/12/pti-make-it-monday-143-modern-whimsy.html?showComment=1386340242101 Handmade Little Things: PTI Make it Monday #143 ~ Modern Whimsy Style The Challenge: PTI Make it Monday #143 ~ Modern Whimsy Style I totally love this style and chose to make a page to filled my 201... pti make it mondaylittle thingshandmade https://emptynestcrafter.blogspot.com/2013/06/make-it-monday-119-flagged-banners.html?showComment=1370516585668 Empty Next Crafter: Make it Monday #119 "Flagged Banners" I honestly can't remember the last time I played along with Make It Monday , but this week's card was so darn cute, I had to make one for ... make it mondayemptynextcrafterflagged https://ppp-makeitmonday.blogspot.com/2012/09/mim107-with-meljens-designs.html?showComment=1347892317064 Make It Monday: MIM#107 with Meljen's Designs Happy Monday to you, Happy Monday to you, Happy MONDAY gorgeous crafters... Happy Monday to you! WOW..you've knocked our socks ... make it mondaymimmeljendesigns https://ginghamgirlsadventures.blogspot.com/2018/04/make-it-monday-stitched-stems.html?showComment=1523842473014 Gingham Girl: Make it Monday: Stitched Stems Playing along with Michelle Leone's Make it Monday at Papertrey Ink! She had the sweetest technique called "Stitched Stems" in which you... make it mondaygingham girlstitchedstems https://ppp-makeitmonday.blogspot.com/2013/11/mim-165-with-saturated-canary.html?m=1 Make It Monday: MIM #165 with Saturated Canary Hi MIM friends! There were so many awesome Halloween entries last week. As the year is drawing to a close your collective Mojo see... make it mondaymimsaturatedcanary https://pinkinkoriginals.blogspot.com/2014/03/pti-make-it-monday-155-confetti.html?showComment=1394658741171 Pink Ink Originals: PTI Make-it-Monday #155 - Confetti Hi there! I absolutely LOVE this week's Make It Monday Challenge over at Papertrey Ink. Danielle shared an adorable project, and I co... pti make it mondaypink inkoriginalsconfetti https://ahiaf.blogspot.com/2015/01/confetti-garlands-make-it-monday-199.html After-Hours Ink & Flowers: Confetti Garlands :Make It Monday #199 make it mondayafter hoursinkflowersconfetti https://ppp-makeitmonday.blogspot.com/2013/07/mim147-with-saturated-canary.html?showComment=1372638062565 Make It Monday: MIM#147 with Saturated Canary Hi MIM friends! It was a huge week here at MIM last week and being a few team members we apologise if we did not manage to visit eac... make it mondaymimsaturatedcanary https://ppp-makeitmonday.blogspot.com/2012/12/mim-121-with-digi-my-world.html?showComment=1356969675714 Make It Monday: MIM #121 with Digi My World Hi MIM Fans! Welcome back. We hope you have all enjoyed the Christmas holiday period. It's just so hard to believe that we are at th... make it mondaymimdigiworld https://maryjdesigns.blogspot.com/2011/12/make-it-monday-sponsored-by-dis-digis.html?showComment=1325254747385 Where's my creativity?: Make It Monday sponsored by Di's Digis! Happy Boxing Day everyone ! I hope you enjoyed your Xmas day - we had a fab time at my parents and today Steve and I are just veging out wi... make it mondaymy creativitysponsored by https://bitsandpiecesdesigns.blogspot.com/2017/09/make-it-monday-296.html?showComment=1505241645727 Bits & Pieces: Make It Monday #296 The challenge this week at Make It Monday is to use some of those little images that come in your stamps sets and repeat them on your card.... make it mondaybitspieces https://emptynestcrafter.blogspot.com/2011/02/make-it-monday-personal-best.html Empty Next Crafter: Make It Monday Personal Best To say I embraced the first Make It Monday challenge would be an understatement. It is not often that I can honestly say "I did my best, I t... make it mondayemptynextcrafterpersonal https://afternoonstamper.blogspot.com/2013/01/pti-make-it-monday-what-to-do-with.html Afternoon Stamper: PTI Make It Monday - What To Do With Oversized Cards Papertrey Ink 's Make It Monday series has hit 100! In honor, one lucky winner will win a $100 gift certificate to Papertrey Ink. I could ... pti make it mondaywhat to do https://ppp-makeitmonday.blogspot.com/2012/06/mim-92-with-pretty-little-ribbon-shop.html?showComment=1338914784300&m=0 Make It Monday: MIM #92 with Pretty Little Ribbon Shop Hi MIM fans! Welcome back to another week of creative inspiration. Again this week you can get to know the MIM team a little better by ... make it mondaypretty littlemimribbonshop https://michelle-pinkpaperparadise.blogspot.com/2011/07/make-it-monday-47-with-crafty-emmas.html?showComment=1311752170712 Pink Paper Paradise: Make It Monday #47 with Crafty Emma's Store . Hey Ho MIM fans, here we are again!! These linky parties sure do come round quick!! Loads and loads of amazing entries last week. Congra... make it mondaypink paper https://ppp-makeitmonday.blogspot.com/2013/06/mim-146-with-cc-designs.html?showComment=1372039857816&m=0 Make It Monday: MIM #146 with C.C. Designs Hi MIM friends. Welcome back for another creative week. Thank you to everyone who entered the DT call that was posted last week. ... make it mondaymimcdesigns https://lalkygirl-my-creative-place.blogspot.com/2012/11/make-it-monday-linky-party-open-again.html My creative Place: Make it Monday Linky party open again Hi all It is Make it Monday challenge day again ...whew those weeks are flying by it will soon be valentines day .....lol This week the ... make it mondaymy creativelinky partyplaceopen https://scraptherapysessions.blogspot.com/2010/08/make-it-monday-fussy-cutting-with-helen.html Scraptherapy Sessions: Make It Monday Fussy Cutting With Helen Jolly This weeks Make It Monday i will be doing one of the things i love most and thats fussy cutting Now dont go freaking out on me !!!! Step 1 C... make it mondayfussy cuttingscraptherapysessionshelen https://handmade-little-things.blogspot.com/2014/08/pti-make-it-monday-174-diamond.html Handmade Little Things: PTI Make it Monday #174 ~ Diamond Wallpaper Stamping The Challenge: PTI Make it Monday #174 ~ Diamond Wallpaper Stamping I sure had fun with this one.... here you see I stamped... pti make it mondaylittle thingshandmade https://maryjdesigns.blogspot.com/2012/02/make-it-monday-sponsored-by-bugaboo.html?showComment=1328533255160 Where's my creativity?: Make It Monday sponsored by Bugaboo Stamps! Yay, a new party has linked up to the Make It Monday party! This week we are being sponsored by one of my most fave fun companies - Bugabo... make it mondaymy creativitysponsored by https://leighpenner.blogspot.com/2015/10/make-it-monday-228.html TO THE FULL: Make It Monday #228 Happy Halloween! We're off to Central Canada Comic Con (C4) in Winnipeg today, but before we leave, I want to share a card that I mad... make it mondayto thefull https://cardsbyrbowen.blogspot.com/2013/03/make-it-monday-time.html?showComment=1364195952904 Simply cute: Make it Monday time! It's Sunday night here...Monday in Australia...so it must be time for a fabulous new OPEN PAPER challenge at Make it Monday !!! Every week... make it mondaysimplycutetime https://savegreenbeinggreen.blogspot.com/2014/04/make-it-monday-at-home-gourmet-iced.html?showComment=1397488572978 Save Green Being Green: Make It Monday: At Home Gourmet Iced Coffee Save yourself $4-5 from going to a coffee shop and make yourself a gourmet iced coffee at your home for MUCH less. I generally like to do... make it mondayat homesavegreen https://ppp-makeitmonday.blogspot.com/2012/06/mim-93-with-bugaboo-stamps.html?showComment=1339409594119 Make It Monday: MIM #93 with Bugaboo Stamps Hi MIM fans!! I hope you have all had a fabulously creative week! By the look of the amazing entries linked up last week I'd say you... make it mondaymimbugaboostamps https://savegreenbeinggreen.blogspot.com/2013/01/make-it-monday-slow-cooker-white-chili.html?showComment=1359258198181 Save Green Being Green: Make It Monday: Slow Cooker White Chili Recipe Have I ever mentioned that I love cooking in the slow cooker? I do. It is wonderful to be able to prepare something ahead of time and let it... make it mondayslow cookersavegreen https://maryjdesigns.blogspot.com/2012/02/make-it-monday-sponsored-by-bugaboo.html?showComment=1328607040780 Where's my creativity?: Make It Monday sponsored by Bugaboo Stamps! Yay, a new party has linked up to the Make It Monday party! This week we are being sponsored by one of my most fave fun companies - Bugabo... make it mondaymy creativitysponsored by https://christinamaclaren.blogspot.com/2011/02/papertrey-ink-make-it-monday-challenge.html?showComment=1297215605137 SeaGlass Papercrafts: Papertrey Ink Make it Monday Challenge All supplies from Papertrey Ink unless noted: Cardstock: Hawaiian Shores, Orange Zest, white Stamps: Star Prints, Mat Stack 2 Collection, ... make it mondaypapertrey inkseaglasspapercraftschallenge https://danielleflanders.blogspot.com/2014/06/make-it-monday-vellum-overlays.html?showComment=1403818262678 Homespun with Heart: Make It Monday: Vellum Overlays. If you know me, you'll know how much I love the soft look of vellum and layering! So today's Make It Monday video at Papertrey Ink is all a... make it mondaywith hearthomespunvellumoverlays https://purplejetlovescrafts.blogspot.com/2015/08/the-memory-nest-make-it-monday-45.html Purplejet Loves Crafts: The Memory Nest - Make It Monday 45 Ready for a new challenge at The Memory Nest ? Well just take a peek at the new Make It Monday sketch and you're bound to be itching to g... purplejet loves craftsthe memory nestmake it monday https://chezparmentier.blogspot.com/2014/12/pti-make-it-monday-191-glittered-frames.html?showComment=1417528793658 Chez Parmentier: PTI Make it Monday #191 glittered frames Papier, Stempels, Mooie teksten, Kleur en Inspiratie. pti make it mondaychez parmentierglitteredframes https://ppp-makeitmonday.blogspot.com/2011/04/mim-34.html?showComment=1304000364138 Make It Monday: MIM #34 Welcome to the brand spankin new Make It Monday blog for this our 34th weekly inspirational linky party. Your continual support has been ... make it mondaymim https://ppp-makeitmonday.blogspot.com/2011/05/make-it-monday-39.html?showComment=1306761186611&m=0 Make It Monday: Make It Monday #39 Hi there crafters, thanks for joining us again this week. It's always nice to have you stop by. Last week was another fantastic turn out. S... make it monday https://maryjdesigns.blogspot.com/2012/02/make-it-monday-sponsored-by-dis-digis.html?showComment=1330544718840 Where's my creativity?: Make It Monday sponsored by Di's Digis! A new linky party has opened over at Make It Monday and here is my make for it... This is Go Green by MilkCoffee and I just love this... make it mondaymy creativitysponsored by https://ppp-makeitmonday.blogspot.com/2013/01/mim-122-with-saturated-canary.html?showComment=1357611375090 Make It Monday: MIM #122 with Saturated Canary Hi MIM fans! Welcome back for another fun week filled with all the creative inspiration you can handle. Last week was a little quiet... make it mondaymimsaturatedcanary https://susanrob.blogspot.com/2011/07/make-it-monday-21.html Three Blossoms: Make it Monday #21 Here is my first attempt at the Make it Monday challenge for this week at Papertrey Ink. I used Botanical Silhouettes, Daydreamer and Think ... make it mondaythreeblossoms https://ppp-makeitmonday.blogspot.com/2012/07/make-it-monday-96-with-digi-doodle-shop.html?showComment=1341235257030 Make It Monday: Make It Monday #96 with Digi Doodle Shop Hi MIM fans! Hope you have all had a fabulous week! We have some new faces in the crowd again this week. Welcome to you! For a... make it mondaydigi doodleshop https://prettyperiwinkle.blogspot.com/2018/08/papertrey-ink-make-it-monday-petite.html?showComment=1533590032330&m=0 Pretty Periwinkle: Papertrey Ink Make-It-Monday: Petite Pattern Play Happy Monday! I am over on the Papertrey Ink Blog today for the latest in the Make-It-Monday series for my version of 'Petite Pattern Play'... make it mondaypapertrey inkprettyperiwinklepetite https://savegreenbeinggreen.blogspot.com/2014/06/make-it-monday-zucchini-patties.html Save Green Being Green: Make It Monday: Zucchini Patties This is a super simple and filling clean eating recipe. They are great on their own or as a vegetable side. I like to top mine with hot s... make it mondaysavegreenzucchinipatties https://ppp-makeitmonday.blogspot.com/2011/07/make-it-monday-45.html?m=0 Make It Monday: Make It Monday #45 Hi there MIM fans how are you today? Did you have a fantastic weekend? Some of you are still enjoying the last of it hopefully. Loads of f... make it monday https://gerispaperwishes.blogspot.com/2013/02/pti-make-it-mondayon-saturday.html paper wishes: PTI Make it Monday...on a Saturday;)... Hello, all! I was looking around for a little non-holiday inspiration today and got a second look at PTI's MIM challenge... pinwheels . O... pti make it mondaypaper wishessaturday https://ppp-makeitmonday.blogspot.com/2012/08/mim-102-with-digi-doodle-shop.html?showComment=1344894752041 Make It Monday: MIM #102 with Digi Doodle Shop Hi MIM fans! Here we are again, time for a brand new linky party. We had so much fun last week, I hope you all got to check out plen... make it mondaydigi doodlemimshop https://lalkygirl-my-creative-place.blogspot.com/2012/12/make-it-monday-linky-party-now-open.html My creative Place: Make it monday linky party ...now open Hi all I hope you all had a wonderful festive break with loved ones... It is Make it monday linky time again and this week the ponsors ... make it mondaymy creativelinky partyplaceopen https://michelle-pinkpaperparadise.blogspot.com/2010/09/make-it-monday-3.html?showComment=1284964869093 Pink Paper Paradise: Make It Monday #3 . Happy Monday! Oh what a wonderful relaxing morning, waking up with cuddles from my boys, no rush to get up and get going. What's not to... make it mondaypink paperparadise https://michelle-pinkpaperparadise.blogspot.com/2012/08/make-it-monday-101-with-bugaboo-stamps.html?showComment=1344250996538 Pink Paper Paradise: Make It Monday #101 with Bugaboo Stamps Hi, nice to see you here. Another week done and dusted and new one starts today. It was a big week over at Make It Monday last week... make it mondaypink paperparadisebugaboostamps https://ppp-makeitmonday.blogspot.com/2012/06/mim-95-with-cupcake-cards-craft.html?showComment=1340692077617 Make It Monday: MIM #95 with Cupcake Cards & Craft Hi there MIM fans, welcome back for another creative link up. Huge week last week with lots of gorgeous entries. Welcome to our new ... make it mondaymimcupcakecardscraft https://savegreenbeinggreen.blogspot.com/2012/06/make-it-monday-frozen-fruit-berry-pops.html?showComment=1340660307962 Save Green Being Green: Make It Monday: Frozen Fruit & Berry Pops (Clean Eating) These are super simple to make and healthy too. By adding in some protein powder (Thanks to my friend Diane for the idea) you can amp up the... make it monday https://adventuresinpaperland.blogspot.com/2013/06/make-it-monday-144-with-nicecrane.html Adventures in Paperland: Make It Monday #144 with Nicecrane Designs Before we kick off another linky party at Make It Monday I want to take a moment to say farewell to Meihsia Liu who is stepping down... adventures in paperlandmake it mondaynicecranedesigns https://linscraftcorner-linda.blogspot.com/2011/12/make-it-monday-45-participants-3.html Lin's Craft Corner: Make It Monday #45 Participants - 3 I used the Stitches and Swirls (love this stamp set) again for this card and the sentiment from Botanical Silhouettes. Then colored with Co... make it mondaycraft cornerlinparticipants https://ppp-makeitmonday.blogspot.com/2013/08/mim-153-with-stampart-design-by-kathryne.html?showComment=1376348491362 Make It Monday: MIM #153 with StampArt Design by Kathryne Hi MIM friends! Wow, what an awesome week last week! Thank you to everyone who joined in the fun. I am certainly glad it is up to M... make it mondaystampart designmim https://craftingwhileiwait.blogspot.com/2016/03/good-morning-paper-crafting-friends-im.html?showComment=1457197828435 Crafting While I Wait: PTI ~ Make-it Monday and Other Fun Challenges pti make it monday https://michelle-pinkpaperparadise.blogspot.com/2012/01/make-it-monday-73-with-cupcake-cards.html?showComment=1327347317812 Pink Paper Paradise: Make It Monday #73 with Cupcake Cards and Craft Hi Well, that last six weeks certainly zipped past pretty quick!! My boys are back at school today after six weeks school holidays. We h... make it mondaypink paper https://leighpenner.blogspot.com/2014/09/make-it-monday-179.html?showComment=1410727929709 TO THE FULL: Make It Monday #179 make it mondayto thefull https://ppp-makeitmonday.blogspot.com/2012/04/make-it-monday-84.html?showComment=1334175666317 Make It Monday: Make It Monday #84 Happy Easter MIM fans!! I hope you have all enjoyed the long weekend and were able to spend quality time with family and friends. It w... make it monday https://distresseddonnadownhome.blogspot.com/2014/12/make-it-monday-17.html Distressed Donna Down Home: Make It Monday #17 Welcome to the Last Make It Monday We want to see your creative projects, delicious recipes, furniture transformations, and thrifty... make it mondaydonna downdistressed https://maryjdesigns.blogspot.com/2012/02/make-it-monday-sponsored-by-meljen.html?showComment=1329733414421 Where's my creativity?: Make It Monday sponsored by Meljen Designs! It's Monday which means a new linky party is open over at Make It Monday ! And we have again as our sponsors the lovely Meljen Designs Digit... make it mondaymy creativitysponsored by https://ppp-makeitmonday.blogspot.com/2011/10/make-it-monday-61.html?showComment=1320256145489 Make It Monday: Make It Monday #61 Hi MIM fans, always nice to see you here. I'm guessing many of you are gearing up for Halloween, carving pumpkins, adding the finishing to... make it monday https://madebynicole.blogspot.com/2012/06/make-it-monday-fathers-day-cards.html?showComment=1338919887149 Made by Nicole: Make It Monday: Father's Day Cards I LOVE Make it Monday but I rarely participate unless I make an effort to do the challenge on Monday itself. Otherwise the week drags on a... make it mondaymade bynicolefathercards https://createwithjulia.blogspot.com/2014/04/make-it-monday-easter-tag-cards.html?showComment=1398264557079 Create With Me: Make It Monday - Easter Tag Cards Today I have something I made for the PTI Make It Monday Challenge - Heat Embossing on die cuts. I needed 3 special Easter Cards for my g... create with memakemondayeastertag https://ginghamgirlsadventures.blogspot.com/2011/02/make-it-mondaywith-glitter-and-tape.html?showComment=1298500165159 Gingham Girl: Make it Monday...with glitter and tape! For Papertrey Ink's new feature, "Make it Mondays"! This week, we were to make a card with "glittered up" tape! Here is my card: I... make it mondaygingham girlglittertape https://pinkinkoriginals.blogspot.com/2011/08/make-it-monday-29-freestyle-copic.html?showComment=1314446027867 Pink Ink Originals: Make it Monday #29 - Freestyle Copic Coloring Can you tell the kiddos are back to school? Two posts in one day?!?! LOL! This weeks PTI Make It Monday Challege says it's ok to c... make it mondaypink inkoriginalsfreestylecopic https://distresseddonnadownhome.blogspot.com/2014/12/make-it-monday-14.html Distressed Donna Down Home: Make It Monday #14 Welcome to another Make It Monday We want to see your creative projects, delicious recipes, furniture transformations, and thrifty ... make it mondaydonna downdistressed https://purplejetlovescrafts.blogspot.com/2015/02/the-memory-nest-make-it-monday-33.html?m=0 Purplejet Loves Crafts: The Memory Nest - Make It Monday 33 Wow! It's time for the first February challenge at The Memory Nest already. I loved looking at all your entries last month and I'm lookin... purplejet loves craftsthe memory nestmake it monday https://ppp-makeitmonday.blogspot.com/2013/08/?m=0 Make It Monday: 08/01/2013 - 09/01/2013 make it monday https://savegreenbeinggreen.blogspot.com/2013/06/make-it-monday-berry-good-rhubarb-sauce.html Save Green Being Green: Make It Monday: Berry Good Rhubarb Sauce This is so delicious, you are going to want to make more than one batch so that you can freeze or can some to have other times of the year! ... make it mondayberry goodsavegreenrhubarb https://ppp-makeitmonday.blogspot.com/2012/07/make-it-monday-99-with-digi-my-world.html?showComment=1343069289053&m=0 Make It Monday: Make It Monday #99 with Digi My World Well hello MIM fans!! Wow, seriously, what an amazing week last week, over 300 entries which is our biggest week ever! Thank you to... make it mondaydigiworld https://purplejetlovescrafts.blogspot.com/2015/03/the-memory-nest-make-it-monday-35.html?m=0 Purplejet Loves Crafts: The Memory Nest - Make It Monday 35 The beginning of March and the first of the Make It Monday challenges at The Memory Nest . This sketch was such a fun one to work with and h... purplejet loves craftsthe memory nestmake it monday