https://www.judiciary.uk/judgments/al-maktoum-judgments/
Al Maktoum judgments - Courts and Tribunals Judiciary
Jul 6, 2022 - By Order of Sir Andrew Macfarlane, President of the Family Division, the judgments below are being made public. i The Foreign Act of State Judgment dated 29...
courts and tribunalsmaktoumjudgmentsjudiciary
https://www.arabnews.com/tags/sheikh-hamdan-bin-mohammed-bin-rashid-al-maktoum-0
Sheikh Hamdan bin Mohammed bin Rashid Al-Maktoum | Arab News
rashid al maktoumsheikh hamdanbinmohammedarab
https://www.zawya.com/en/press-release/companies-news/submission-deadline-for-5th-cycle-of-the-mohammed-bin-rashid-al-maktoum-global-water-award-extended-to-30-september-2026-ye5j155t
Submission deadline for 5th cycle of the Mohammed bin Rashid Al Maktoum Global Water Award extended...
The extension comes in response to growing global interest in the award
https://www.amnesty.org/en/documents/mde25/8977/2018/en/
United Arab Emirates: Six months after her capture at sea, Sheikha Latifa al Maktoum still held...
Jun 1, 2021 - Today marks six months since Sheikha Latifa Mohammed bin Rashid Al Maktoum and five other people were detained at sea by Indian and United Arab Emirates (UAE)...
https://www.businesswire.com/news/home/20260325551161/en/Office-of-His-Highness-Sheikh-Hamdan-Bin-Ahmed-Al-Maktoum-Holdings-Gatbits-IT-Infrastructure-Announce-Launch-of-GTBS-Digital-Ecosystem-Mainnet-Set-for-April-2026
Office of His Highness Sheikh Hamdan Bin Ahmed Al Maktoum Holdings & Gatbits IT Infrastructure...
GTBS Digital Ecosystem officially announced the launch of its native GTBS Coin on December 25.
https://www.khaleejtimes.com/uae/dubais-new-airport-first-phase-of-al-maktoum-international-airport-to-be-ready-by-2032
Dubai: Robots carrying bags? Al Maktoum International to be 'borderless' airport, says official |...
Once operational, it will start taking over all flight operations from Dubai International Airport (DXB). As part of the move, a Dh1-billion contract has been...
al maktoum international
https://www.thenationalnews.com/sport/al-maktoum-challenge-round-2-furia-cruzada-gets-another-chance-at-meydan-1.89052
Al Maktoum Challenge Round 2: Furia Cruzada gets another chance at Meydan | The National
Jun 15, 2021 - The American-bred Chilean challenger lines up as the only mare of the nine runners engaged in the Group 2 Al Maktoum Challenge Round 2 at Meydan Racecourse.
al maktoum challenge round 2
https://www.wikidata.org/wiki/Q340089
Maktoum bin Hushur - Wikidata
maktoum bin hushurwikidata
https://almaktoumcorporate.com/
Al Maktoum
At Al Maktoum Corporate Services, we specialize in helping entrepreneurs and companies set up their businesses seamlessly. Whether you're starting a small...
almaktoum
https://almaktoumoffice.com/
Al Maktoum Holding FZC | Office Shaikh Abdulhakim
al maktoumholdingfzcofficeshaikh
https://www.wam.ae/en/details/1395303048980
Hamdan bin Mohammed, Maktoum bin Mohammed issue directives to set up task force to track digital...
H.H. Sheikh Hamdan bin Mohammed bin Rashid Al Maktoum, Crown Prince of Dubai and Chairman of Dubai Executive Council, and H.H. Sheikh Maktoum bin Mohammed bin...
https://www.trip.com/carhire/to-united-arab-emirates-9/dubai-220/al-maktoum-international-airport-dwc/
Al Maktoum International Airport Car Rental - Cheapest Rates from US$185.00 | Trip.com
Looking for cheap car rentals at Al Maktoum International Airport? Compare top car rental companies like AVIS, SIXT, and Europcar on Trip.com. Book now and get...
al maktoum international
https://rss.com/podcasts/dewa-news/2552033/
92nd meeting was chaired by HH Sheikh Ahmed bin Saeed Al Maktoum Dubai Supreme Council of Energy...
92nd meeting was chaired by HH Sheikh Ahmed bin Saeed Al MaktoumDubai Supreme Council of Energy reviews 2025 clean energy progress and performance outcomes
https://www.prnewswire.com/in/news-releases/mohammed-bin-rashid-al-maktoum-knowledge-foundation-1st-arab-organisation-named-knowledge-partner-by-un-693959251.html
Mohammed bin Rashid Al Maktoum Knowledge Foundation 1st Arab Organisation Named 'Knowledge Partner'...
/PRNewswire/ -- Ceremony took place on the sidelines of the General Assembly's meeting The United Nations Development Program (UNDP) has honoured the...
rashid al maktoumknowledge foundation
https://cleantechnica.com/tag/mohammad-bin-rashid-al-maktoum-solar-park/
Mohammad Bin Rashid Al Maktoum Solar Park Archives | CleanTechnica
mohammad bin rashidal maktoumsolar parkarchivescleantechnica
https://www.zentalityinfo.com/
Zentality | Cheap Mobile Accessories,Tablets Laptop | Al Reem Tower - Al Maktoum Road - Dubai -...
mobile accessories
https://gulfnews.com/photos/business-photos/in-pictures-dubais-al-maktoum-international-airport-to-be-worlds-largest-1.1714307105674
In Pictures: Dubai's Al Maktoum International Airport to be world's largest
Sheikh Mohammed approved the designs for the project, set to be built at a cost of Dh128b
al maktoum international
https://www.emirates247.com/business/economy-finance/maktoum-bin-mohammed-chairs-meeting-of-higher-committee-for-development-of-economic-and-financial-sector-in-dubai-2025-05-11-1.739190
Maktoum bin Mohammed chairs meeting of Higher Committee for Development of Economic and Financial...
May 11, 2025 - H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister, Minister of Finance, and Chairman of the Higher Comm
https://www.magnumphotos.com/arts-culture/eve-arnold-in-the-trucial-states-the-united-arab-emirates-before-federation/attachment/india-dubai-prince-maktoum-younger-son-of-the-ruler-of-dubai-1971/
INDIA. Dubai. Prince Maktoum, younger son of the ruler of Dubai. 1971. | Magnum Photos
INDIA. Dubai. Prince Maktoum, younger son of the ruler of Dubai. 1971.
son of
https://www.emirates247.com/world/mohammed-bin-rashid-al-maktoum-global-initiatives-sends-emergency-humanitarian-aid-to-250-000-people-in-lebanon-2024-10-10-1.734405
Mohammed bin Rashid Al Maktoum Global Initiatives sends emergency humanitarian aid to 250,000...
Oct 10, 2024 - Under the directives of His Highness Sheikh Mohammed bin Rashid Al Maktoum, Vice President, Prime Minister and Ruler of Dubai, the Mohammed bin Rashid Al Maktou
https://www.businesswire.com/news/home/20231207407942/en/4th-Cycle-of-the-Mohammed-bin-Rashid-Al-Maktoum-Global-Water-Award-Launched
4th Cycle of the Mohammed bin Rashid Al Maktoum Global Water Award Launched
4th cycle of the Mohammed bin Rashid Al Maktoum Global Water Award launched
rashid al maktoum
https://www.myjoyonline.com/sputnik-v-vaccines-sheikh-ahmed-dalmook-al-maktoum-initially-demanded-between-28-and-38-per-dose-health-minister/
Sputnik V vaccines: Sheikh Ahmed Dalmook Al Maktoum initially demanded between $28 and $38 per dose...
Jul 15, 2021 - The Health Minister says businessman Sheikh Ahmed Dalmook Al Maktoum, who has terminated a contract with the government of Ghana to supply Sputnik V vaccines,...
https://www.businesswire.com/news/home/20240820939154/nl
Onder het beschermheerschap van Mohammed bin Rashid Al Maktoum Dubai wordt in september het...
Onder het beschermheerschap van Zijne Hoogheid Sheikh Mohammed bin Rashid Al Maktoum, vice-president en premier van de VAE en heerser van Dubai, organiseert ...
rashid al maktoum
https://www.thenationalnews.com/lifestyle/family/2022/11/24/sheikh-hamdan-wishes-sheikh-maktoum-a-happy-birthday/
Sheikh Hamdan wishes Sheikh Maktoum a happy birthday | The National
Nov 24, 2022 - Dubai's Deputy Ruler turns 39 on November 24
a happy birthdaysheikh hamdanwishesmaktoumnational
https://www.globenewswire.com/fr/news-release/2024/09/24/2952462/0/en/Sheikh-Al-Maktoum-NEO-Technologies-Explores-Investment-Opportunities-with-Panama.html
Sheikh Al Maktoum NEO Technologies Explores Investment
Sheikh Al Maktoum NEO Technologies hosted a pivotal meeting at its Dubai offices with key officials from the Republic of Panama....
al maktoumsheikhneotechnologiesexplores
https://www.emirates247.com/uae/maktoum-bin-mohammed-chairs-meeting-of-dubai-judicial-council-approves-project-to-enhance-judicial-competencies-2024-11-10-1.735273
Maktoum bin Mohammed chairs meeting of Dubai Judicial Council, approves project to enhance judicial...
Nov 10, 2024 - H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister and Minister of Finance of the UAE, and Chairman of t
https://menafn.com/1110987252/Mohammed-Bin-Rashid-Al-Maktoum-Knowledge-Award-Trustees-Review-Nominations-For-2026-Edition
Mohammed Bin Rashid Al Maktoum Knowledge Award Trustees Review Nominations For 2026 Edition
Mohammed Bin Rashid Al Maktoum Knowledge Award Trustees Review Nominations For 2026 Edition. The Board of Trustees of the Mohammed bin Rashid Al Maktoum...
rashid al maktoum
https://www.zawya.com/en/business/energy/maktoum-bin-mohammed-meets-with-ceo-of-siemens-energy-ibsruy0o
Maktoum bin Mohammed meets with CEO of Siemens Energy
The meeting discussed global developments in the energy sector and the accelerating shift towards clean and renewable energy systems
maktoumbinmohammedmeetsceo
https://menafn.com/1097006919/Al-Maktoum-Foundation-concludes-its-Ramadan-poragmmes-in-Maghagha-Egypt?src=RSS
Al Maktoum Foundation concludes its Ramadan poragmmes in Maghagha, Egypt
Al Maktoum Foundation concludes its Ramadan poragmmes in Maghagha, Egypt.) CAIRO, 12th June, 2018 (WAM) -- Al Maktoum Foundation concluded its Ramadan...
al maktoumfoundationconcludesramadanmaghagha
https://www.mid-day.com/amp/buzzfeed/article/office-of-his-highness-sheikh-hamdan-bin-ahmed-al-maktoum-holdings-announces-the-official-launch-of-the-gtbs-digital-ecosystem-on-december-25-9246
Office of His Highness Sheikh Hamdan Bin Ahmed Al Maktoum Holdings Announces the Official Launch of...
GTBS launches its Web3 ecosystem and GTBS Coin, integrating blockchain, AI, DeFi, gaming and cloud services.
https://www.egyptindependent.com/tag/his_highness_sheikh_mohammed_bin_rashid_al-maktoum/
His Highness Sheikh Mohammed bin Rashid al-Maktoum Archives - Egypt Independent
rashid al maktoumhis highnesssheikh mohammedbin
https://www.zawya.com/en/press-release/government-news/submission-deadline-for-5th-cycle-of-the-mohammed-bin-rashid-al-maktoum-global-water-award-extended-to-30-september-2026-morjiksh
Submission deadline for 5th cycle of the Mohammed bin Rashid Al Maktoum Global Water Award extended...
Aims to enable the widest possible participation from applicants around the world
https://www.businesswire.com/news/home/20240507709620/en/Mohammed-bin-Rashid-Al-Maktoum-Global-Water-Award-extends-application-deadline-until-end-of-May
Mohammed bin Rashid Al Maktoum Global Water Award extends application deadline until end of May
Mohammed bin Rashid Al Maktoum Global Water Award extends application deadline until end of May
https://www.businesswire.com/news/home/20240820506466/en/Under-the-Patronage-of-Mohammed-bin-Rashid-Al-Maktoum-Dubai-to-Host-Annual-World-Congress-of-the-World-Free-Zones-Organization-in-September
Under the Patronage of Mohammed bin Rashid Al Maktoum Dubai to Host Annual World Congress of the...
Under the patronage of Mohammed bin Rashid Al Maktoum Dubai to host annual world congress of the World Free Zones Organization in September
https://www.ndtv.com/topic/mohammed-bin-rashid-al-maktoum
Mohammed Bin Rashid Al Maktoum: Latest News, Photos, Videos on Mohammed Bin Rashid Al Maktoum -...
rashid al maktoumlatest newsmohammedbinphotos
https://www.racingpost.com/profile/owner/204306/sheikh-rashid-dalmook-al-maktoum
Sheikh Rashid Dalmook Al Maktoum | Record By Race Type | Racing Post
Owner Sheikh Rashid Dalmook Al Maktoum statistics and form. View results and future entries as well as statistics by course, race type and prize money.
al maktoumby racesheikhrashid
https://anyflip.com/eyzbg/ghwv
My Story by Al Maktoum, Mohammed bin Rashid Al Maktoum, Mohammed - sksacredheart Flip PDF | AnyFlip
Check My Story by Al Maktoum, Mohammed bin Rashid Al Maktoum, Mohammed from sksacredheart here. Like My Story by Al Maktoum, Mohammed bin Rashid Al Maktoum,...
my storyal maktoum
https://www.wam.ae/en/article/bjgeold-maktoum-bin-mohammed-meets-with-president-group
Maktoum bin Mohammed meets with President, Group CEO of Mizuho Financial Group | Emirates News...
H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister, Minister of Finance, and President of the Dubai...
https://www.thenationalnews.com/sport/football/al-nasr-manager-benat-san-jose-very-proud-to-face-arsenal-in-official-opening-of-al-maktoum-stadium-1.841007
Al Nasr manager Benat San Jose 'very proud' to face Arsenal in official opening of Al Maktoum...
Feb 5, 2026 - Dubai club will take on their Premier League counterparts on Tuesday to celebrate the refurbishment of their ground
https://www.saeedalmaktoum.com/
WELCOME TO OFFICE OF SHIEKH SAEED BIN HASHER AL MAKTOUM
Our services help our clients save money while also acting as a conduit and support for the development of commercial prospects and partnerships between Dubai...
welcome toofficeshiekhsaeedbin
https://www.visitdubai.com/en/places-to-visit/al-maktoum-international-airport
Al Maktoum International Airport at Dubai World Central
Al Maktoum International Airport will be the largest airport in the world, anchoring the new residential-commercial-logistics development Dubai World Central.
al maktoum internationaldubai worldairportcentral
https://artdaily.cc/news/152457/-Rythms-of-the-Deep--By-Her-Highness-Sheikha-Maytha-Bint-Obaid-Al-Maktoum--at-Firetti-Contemporary
"Rythms of the Deep: By Her Highness Sheikha Maytha Bint Obaid Al Maktoum" at Firetti Contemporary
a href= http://www.firetticontemporary.com target= _blank Firetti Contemporary /a has announced a one-of-a-kind multi-sensory solo exhibition by H
https://www.indiatimes.com/worth/news/wheels-up-dubai-al-maktoum-international-airport-set-to-soar-with-400-gates-and-5-runways/articleshow/122539783.html
Wheels Up, Dubai! Al Maktoum International Airport Set To Soar With 400 Gates And 5 Runways
Construction commenced on a new terminal at Al Maktoum International Airport in Dubai on Sunday. The ruler of the Gulf emirate declared it as "the world's...
https://www.wam.ae/en/article/15vo0sh-final-rounds-sheikha-hind-bint-maktoum-quran
Final rounds of Sheikha Hind bint Maktoum Quran competition conclude | Emirates News Agency
The final rounds of the Sheikha Hind bint Maktoum Quran Competition, organised by the Islamic Affairs and Charitable Activities Department in Dubai, concluded...
hind bint maktoum
https://unioncore.ae/
Best VAT Consultants in Al Maktoum Road Deira Dubai
Professional VAT consultants in Dubai offering VAT registration, filing, and tax advisory. Trusted services to keep your UAE business compliant.
al maktoum roadbestvatconsultantsdeira
https://www.emirates247.com/news/emirates/flydubai-to-shift-to-al-maktoum-airport-2011-11-16-1.428632
Flydubai to shift to Al Maktoum Airport - Emirates 24|7
Nov 16, 2011 - Flydubai will shift operations to Al Maktoum International Airport in Jebel Ali, according to Sheikh Ahmed bin Saeed Al Maktoum, President of Dubai Department o
al maktoum airportflydubaishiftemirates24
https://gulfnews.com/business/aviation/al-maktoum-a-catalyst-for-development-1.1247124
Al Maktoum a catalyst for development
The completed development is estimated to cost over $32b
al maktoumcatalystdevelopment
https://www.edf.fr/en/edf/edf-group-joins-masdar-led-consortium-developing-phase-3-of-mohammed-bin-rashid-al-maktoum-solar-park
EDF Group joins Masdar-led consortium developing Phase 3 of Mohammed bin Rashid Al Maktoum Solar...
https://www.rentalcars.com/en/airport/ae/dwc/europcar/
Europcar Dubai World Central Al Maktoum International Airport: Car Hire & reviews - Rentalcars.com
Find the best prices on Europcar car hire in Dubai World Central Al Maktoum International Airport and read customer reviews. Book online today with the world's...
dubai world centralairport car hire
https://www.wam.ae/en/article/bhtgry3-maktoum-bin-mohammed-inaugurates-second-phase-moro
Maktoum bin Mohammed inaugurates second phase of Moro Hub Green Data Centre | Emirates News Agency
H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister and Minister of Finance, today inaugurated the...
https://ahmedmaktoum.com/
Office of H.H Sheikh Ahmed Bin Obaid Al Maktoum | Ahmed Maktoum
of hsheikh ahmedofficebinobaid
https://gulfnews.com/uae/mohammed-bin-rashid-al-maktoum-orders-immediate-provision-of-humanitarian-aid-to-displaced-sudanese-1.95489280
Mohammed bin Rashid Al Maktoum orders immediate provision of humanitarian aid to displaced Sudanese
Food, medical supplies and tents will be provided to help the most affected
https://www.emirates247.com/news/maktoum-bin-mohammed-chairs-difc-regular-meeting-2012-11-14-1.483090
Maktoum bin Mohammed chairs DIFC regular meeting - Emirates 24|7
Nov 14, 2012 - Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, Deputy Ruler of Dubai and Chairman of the Higher Board of Directors of DIFC on Tuesday presided over the Boar
regular meetingmaktoumbinmohammedchairs
https://www.emirates247.com/business/economy-finance/maktoum-bin-mohammed-2025-federal-budget-demonstrates-uae-s-keenness-to-harness-all-available-resources-to-meet-sustainable-development-goals-2024-10-09-1.734346
Maktoum bin Mohammed: 2025 Federal Budget demonstrates UAE's keenness to harness all available...
Oct 9, 2024 - H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister, and Minister of Finance, stated: "The 2025 federal b
https://www.khaleejtimes.com/uae/dubai-new-dh55-billion-community-with-ponds-parks-to-be-built-near-al-maktoum-airport?_refresh=true
Dubai: New Dh55-billion community with ponds, parks to be built near Al Maktoum airport | Khaleej...
The community was launched by real-estate developer Emaar Properties on Tuesday
https://dwc.dubaiairports.ae/
Dubai World Central - Al Maktoum International (DWC)
Explore flight information, services, facilities, and more.
dubai world centralmaktouminternationaldwc
https://www.archdaily.com/1020909/coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae/66dab87e5030bc736b0e1e5d-coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae-image
Gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE - 3
Image 3 of 5 from gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE. Courtesy of COOP HIMMELB(L)AU | Al Maktoum...
https://www.newarab.com/tag/sheikh-mohammed-al-maktoum
Sheikh Mohammed Al Maktoum | The New Arab
Sheikh Mohammed Al Maktoum
sheikh mohammedal maktoumthe newarab
https://www.egyptindependent.com/tag/sheikh_ahmed_bin_saeed_al_maktoum/
Sheikh Ahmed bin Saeed Al Maktoum Archives - Egypt Independent
ahmed bin saeed al maktoumsheikharchivesegyptindependent
https://www.racingpost.com/news/britain/derby-winning-owner-and-influential-figure-sheikh-mohammed-obaid-al-maktoum-dies-anfWM5i5iIDz/
Derby-winning owner and influential figure Sheikh Mohammed Obaid Al Maktoum dies | Racing Post
Sheikh Mohammed Obaid Al Maktoum, the breeder of Dubawi and owner of star performers including 1998 Derby winner High-Rise, Postponed and Rosallion,... Read...
https://www.archdaily.com/1020909/coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae/66dab8815030bc736b0e1e5e-coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae-image
Gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE - 1
Image 1 of 5 from gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE. Courtesy of COOP HIMMELB(L)AU | Al Maktoum...
https://www.rentalcars.com/en/airport/ae/dwc/
Cheap Car Hire Dubai World Central Al Maktoum International Airport - Rentalcars.com
Compare car rental at Dubai World Central Al Maktoum International Airport DWC and find the cheapest prices from all major brands. Book online today with the...
cheap car hiredubai world central
https://www.wam.ae/en/details/1395303158637
Maktoum bin Mohammed inaugurates Dubai Centre for Family Businesses under Dubai Chambers | Emirates...
In line with the directives of His Highness Sheikh Mohammed bin Rashid Al Maktoum, Vice President, Prime Minister and Ruler of Dubai, to develop an integrated...
https://www.khaleejtimes.com/business/aviation/dubai-all-operations-at-dubai-international-airport-to-be-transferred-to-al-maktoum
Dubai: All operations at Dubai International airport to be transferred to Al Maktoum | Khaleej Times
Set to be five times the size of DXB, Al Maktoum International will span 70 square-km
https://www.fresha.com/a/relaxxa-mens-salon-dubai-hasher-al-maktoum-building-50-10th-street-xxkt4tko
Relaxxa Mens Salon - Hasher Al Maktoum Building 50 10th Street Bldg No. 13 Shop no 7&8 - Dubai |...
https://www.thenationalnews.com/uae/mohammed-bin-rashid-al-maktoum-foundation-carries-out-58-ramadan-projects-1.58241
Mohammed bin Rashid Al Maktoum Foundation carries out 58 Ramadan projects | The National
Jun 15, 2021 - The foundation has carried out a total of 58 charitable Ramadan programmes and projects valued at Dh71,940,000 in the UAE and in Muslim communities in a number...
rashid al maktoum
https://www.emirates247.com/news/government/maktoum-honours-winners-of-rashid-award-2012-11-07-1.482200
Maktoum honours winners of Rashid Award - Emirates 24|7
Nov 7, 2012 - Dubai Deputy Ruler Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum attended the annual ceremony to honour the winners of the Rashid Award for Academic Excelle
maktoumhonourswinnersrashidaward
https://www.fresha.com/lvp/seven-star-gents-saloon-al-maktoum-hospital-road-dubai-Rr7V0D
Seven star Gents saloon - 182 - 1 2c St - opp. Al Maktoum Hospital Road - Deira - Al Rigga - Dubai...
Instantly book salons and spas nearby
https://www.emirates247.com/news/government/maktoum-bin-mohammed-meets-us-official-2011-11-28-1.430581
Maktoum bin Mohammed meets US official - Emirates 24|7
Nov 28, 2011 - Dubai Deputy Ruler, Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum received on Monday at the Zabeel Palace in Dubai, US undersecretary for terrorism and fina
maktoumbinmohammedmeetsus
https://www.zawya.com/en/press-release/government-news/mohammed-bin-rashid-al-maktoum-knowledge-award-trustees-review-nominations-for-2026-edition-qjurv4am
Mohammed bin Rashid Al Maktoum Knowledge Award Trustees review nominations for 2026 edition
Reinforcing its commitment to recognizing and honoring exemplary achievements in the global knowledge and human development domain
rashid al maktoum
https://www.wam.ae/en/article/bm03ffc-maktoum-bin-mohammed-meets-with-president-ceo
Maktoum bin Mohammed meets with President, CEO of PayPal | Emirates News Agency
H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister, and Minister of Finance, today met with Alex...
https://www.wam.ae/en/details/1395303156631
Maktoum bin Mohammed meets with Chairman and CEO of Morgan Stanley | Emirates News Agency
H.H. Sheikh Maktoum bin Mohammed bin Rashid Al Maktoum, First Deputy Ruler of Dubai, Deputy Prime Minister and Minister of Finance of the UAE, and President of...
https://www.thenationalnews.com/sport/horse-racing/matterhorn-in-dubai-world-cup-contention-following-al-maktoum-challenge-victory-at-meydan-1.989524
Matterhorn in Dubai World Cup contention following Al Maktoum Challenge victory at Meydan | The...
Jul 4, 2021 - Salem bin Ghadayer has quite a few options for the $12million race on March 28
https://www.archdaily.com/1020909/coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae/66dab90f5030bc736b0e1e62-coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae-image
Gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE - 5
Image 5 of 5 from gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE. Courtesy of COOP HIMMELB(L)AU | Al Maktoum...
https://trainingzone.co.uk/author/sheikh-mohammed-bin-rashid-al-maktoum/
Sheikh Mohammed Bin Rashid al Maktoum, Author at TrainingZone
rashid al maktoumsheikh mohammedbinauthor
https://www.ainonline.com/aviation-news/business-aviation/2008-11-16/dubai-commits-bizav-al-maktoum-airport
Dubai commits to bizav at Al Maktoum Airport | Aviation International News
Dubai Airports unveiled the new branding of its Executive Flights Centre during the first day at MEBA, and also revealed that part of the first terminal be
al maktoum airportdubaicommitsbizav
https://www.zawya.com/en/business/transport-and-logistics/falcon-plans-100mln-spend-on-al-maktoum-airport-facilities-t5pvplc4
Falcon plans $100mln spend on Al Maktoum airport facilities
GCAA granted CAR 145 approval for launching its MRO operations in the UAE
al maktoum airportfalconplansspendfacilities
https://www.fresha.com/lvp/furtune-seven-spa-al-maktoum-road-dubai-9QLrVD
Furtune Seven Spa - 786C+39 - Al Maktoum Rd - Deira - Riggat Al Buteen - Dubai - United Arab...
Instantly book salons and spas nearby
https://www.khaleejtimes.com/uae/dubai-start-awarding-contracts-al-maktoum-airport
Dubai starts awarding contracts for Al Maktoum International; airport to be world's largest |...
Dubai Contracts: Al Maktoum International airport set to become the world's largest airport, boosting travel capacity to 260 million travellers as part of...
https://www.archdaily.com/1020909/coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae/66dab8783b3d044b35e12c93-coop-himmelb-l-au-designs-new-al-maktoum-international-airport-in-dubai-uae-image
Gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE - 2
Image 2 of 5 from gallery of Coop Himmelb(l)au Designs New Al Maktoum International Airport in Dubai, UAE. Courtesy of COOP HIMMELB(L)AU | Al Maktoum...
https://rss.com/es/podcasts/dewa-news/2552033/
92nd meeting was chaired by HH Sheikh Ahmed bin Saeed Al Maktoum Dubai Supreme Council of Energy...
92nd meeting was chaired by HH Sheikh Ahmed bin Saeed Al MaktoumDubai Supreme Council of Energy reviews 2025 clean energy progress and performance outcomes
https://hipa.ae/
HIPA Hamdan Bin Mohammed Bin Rashid Al Maktoum International Photography Award
The Hamdan Bin Mohammed Bin Rashid Al Maktoum International Photography Awards (HIPA) is a yearly event showcasing some of the most awe-inspiring work of...
rashid al maktoumhipahamdanbinmohammed
https://www.myjoyonline.com/deputy-majority-leader-confirms-receipt-of-2-4m-refunded-by-sheikh-al-maktoum/
Deputy Majority Leader confirms receipt of $2.4m refunded by Sheikh Al Maktoum - MyJoyOnline
Aug 12, 2021 - Deputy Majority Leader in Parliament, Alexander Afenyo Markin, has confirmed that the United Arab Emirates-based agent, in the botched attempt to procure...
https://www.tcd.ie/nmes/our-research/the-hamdan-bin-rashid-al-maktoum-centre-for-middle-eastern-studies/
The Hamdan bin Rashid Al Maktoum Centre for Middle Eastern Studies - Near and Middle Eastern...
hamdan bin rashid al maktoum
https://www.uber.com/global/en/r/airports/dwc/
Al Maktoum International Airport Dropoff: How to Get There | Uber
Explore the best ways to get to Al Maktoum International Airport (DWC), including car and SUV options from Uber. Plan your trip and book a ride today.
how to get thereal maktoum internationalairportdropoffuber
https://www.thenationalnews.com/business/maktoum-airport-earns-its-wings-1.561368
Maktoum airport earns its wings | The National
Jul 7, 2021 - Dubai aviation authorities have announced a successful test flight at Al Maktoum International Airport in Jebel Ali, clearing the way for the airport to...
maktoum airportearnswingsnational
https://www.khaleejtimes.com/uae/watch-sheikh-hamdan-maktoum-review-future-of-emirates-brand
Watch: Sheikh Hamdan, Maktoum review future of Emirates brand | Khaleej Times
Dubai Crown Prince Sheikh Hamdan posted a video on social media of his visit to the Emirates Group Headquarters along with Sheikh Maktoum, First Deputy Rul...
sheikh hamdanfuture ofwatchmaktoumreview
https://www.sramps.sch.ae/
Home - His Highness Shaikh Rashid Al Maktoum Pakistani School Dubai
rashid al maktoumhis highnesspakistani schoolshaikhdubai
https://www.hipa.ae/
HIPA Hamdan Bin Mohammed Bin Rashid Al Maktoum International Photography Award
The Hamdan Bin Mohammed Bin Rashid Al Maktoum International Photography Awards (HIPA) is a yearly event showcasing some of the most awe-inspiring work of...
rashid al maktoumhipahamdanbinmohammed
https://www.prnewswire.com/news-releases/sheikh-mohammed-bin-rashid-al-maktoum-launches-aed30-billion-dubai-wholesale-city---largest-wholesale-hub-worldwide-570773901.html
Sheikh Mohammed Bin Rashid Al Maktoum Launches AED30 Billion 'Dubai Wholesale City' - Largest...
/PRNewswire/ -- His Highness Sheikh Mohammed bin Rashid Al Maktoum, Vice President and Prime Minister of the UAE and Ruler of Dubai, has confirmed that the...
rashid al maktoum
https://seedgroup.com/
Seed Group | A Company of The Private Office of Sheikh Saeed bin Ahmed Al Maktoum