https://polkadot.js.org/extension/
Polkadot-js extension, manage accounts for substrate based chains
This browser extension for Polkadot, Kusama or any other substrate-base blockchain allows to keep all your accounts in one place while being able to interact...
manage accountspolkadotjsextensionsubstrate
https://www.clemson.edu/campus-life/tigerone/accounts/
Manage Accounts
manage accounts
https://doit.illinois.gov/support/manage-passwords.html
Manage Accounts & Passwords
Due to the nature of our complex environment, many users have multiple accounts and managing passwords for those accounts is problematic. Account management is...
manage accountspasswords
https://www.wellsfargo.com/biz/online-banking/manage-accounts/
Manage Accounts with Wells Fargo Business Online®
manage accountswells fargobusiness
https://www.digitaltrends.com/contributor-content/how-adspower-helps-affiliates-and-social-teams-manage-accounts-securely-at-scale/
How Affiliates And Social Teams Manage Accounts Securely At Scale - Digital Trends
AdsPower streamlines multi-account management with automation, strong security, and centralized control, helping digital teams operate more efficiently and...
manage accountsat scaledigital trendsaffiliatessocial
https://multilogin.com/mobile/cloud-phone-for-facebook/
Cloud phone for Facebook: Manage accounts safely for €1.99
Apr 13, 2026 - Run Facebook safely using cloud phones. Manage multiple accounts and ad workflows with isolated environments, no need for physical devices.
cloud phonemanage accountsfacebooksafely
https://www.fileandservexpress.com/add-user-accounts-file-servexpress/
How to Add Users and Manage Accounts on File & ServeXpress - File & ServeXpress
Nov 17, 2023 - Here we answer frequently asked questions about adding and transferring users to your firm, managing forgotten passwords, and more.
how toadd usersmanage accountsfile
https://multilogin.com/dropshipping-and-ecommerce/
Manage multiple e-commerce & dropshipping accounts 2025
e commercemanagemultipledropshippingaccounts
https://opteo.com/
Opteo, the smarter way to manage your Google Ads accounts.
Opteo gives you smart recommendations that improve Google Ads performance. Spend less time buried in performance data and more time doing meaningful work that...
google adssmarterwaymanageaccounts
https://www.bankofamerica.com/online-banking/sign-in/?request_locale=en_US
Log in to Bank of America Online & Mobile Banking to Manage Your Accounts
bank of americalog inmobile bankingyour accountsonline
https://sessionbox.io/
SessionBox One: Manage multiple accounts securely on all platforms
SessionBox One is the app that lets you use multiple accounts on the same site simultaneously without the fear of account banning. Start your free trial and...
multiple accountsall platformsonemanagesecurely
https://planable.io/blog/manage-multiple-twitter-accounts/
How to manage multiple Twitter accounts with ease
Dec 3, 2025 - Effective techniques to seamlessly manage multiple Twitter accounts. Plus practical tips to increase brand awareness.
how tomanagemultipletwitteraccounts
https://fondyflow.io/
Sign in to Fondy Flow | Manage your Business Accounts
sign in tomanage your businessfondyflowaccounts
https://www.bankofamerica.com/mortgage/servicing/
Log in to Manage your Bank of America Mortgage and Home Equity Accounts
Log in to Bank of America Home Loans customer service center to access your mortgage and/or home equity accounts, make payments, view statements and more.
bank of americalog inhome equitymanagemortgage
https://mint.intuit.com/how-mint-works
Manage All Accounts In One Place | Mint
Mint is a free, safe, and simple budget tool. Track spending, investments, credit score and more. Learn more about the features Mint has to offer.
all accountsmanageoneplacemint
https://www.wellsfargo.com/mobile-online-banking/manage-accounts/
Manage Your Accounts with Wells Fargo Online®
Use the Wells Fargo Mobile® app or Wells Fargo Online® to access your accounts, monitor balances and activities, set up alerts, view statements and more with...
your accountswells fargomanage
https://business.google.com/us/ad-tools/manage-accounts/
Manager Accounts: Manage Multiple Google Ads Accounts - Google Ads
Manager Accounts help you manage multiple Google Ads accounts, control access, steamline billing and more, all from one dashboard.
google adsmanageraccountsmultiple
https://handbook.gitlab.com/handbook/support/enhanced-support-offerings/offering-assigned-support-engineer/ase-workflows-and-standards/ase-tickets-or-issues/
ASE - Where to Document and Manage Work for Accounts | The GitLab Handbook
Guide for ASEs about tracking and managing work with their accounts in tickets, issues, and other places
the gitlab handbookasedocumentmanagework
https://docs.oracle.com/en/cloud/get-started/subscriptions-cloud/secure-platform-cloud-services.html
Manage Oracle Cloud Accounts and Services - Manage Users and Access to Cloud Services
Documentation for adding users and controlling access to Cloud services.
accounts and servicesoracle cloudmanageusersaccess
https://flipboard.helpshift.com/hc/en/1-flipboard/faq/966-manage-multiple-accounts/
Manage multiple accounts — Flipboard Help Center
Can I log into multiple accounts at once? You can only log into one account at a time. You will need to sign out of one account to log into
multiple accountshelp centermanageflipboard
https://docs.oracle.com/en/cloud/get-started/subscriptions-cloud/manage-and-monitor-services.html
Manage Oracle Cloud Accounts and Services - Manage Your Account and Services
Documentation that describes how to manage and monitor Oracle Cloud accounts and services, and user accounts and roles.
accounts and servicesoracle cloudmanage
https://www.mailerlite.com/help/how-to-manage-multiple-mailerlite-accounts
How To Manage Multiple MailerLite Accounts - MailerLite
Jan 28, 2026 - If you run an agency or have multiple businesses this will save you time. Learn how to manage your MailerLite accounts for efficiency.
how tomanagemultiplemailerliteaccounts
https://elliotpak.net/how-to-manage-multiple-online-game-accounts-efficiently/
How to Manage Multiple Online Game Accounts Efficiently – My Blog
how toonline gamemy blogmanagemultiple
https://help.tilda.cc/membership
How To Manage Memberships And User Accounts │ Tilda Help Center
Creating user accounts and managing access to exclusive content on Tilda's Members Area
how tomanage membershipsuser accountshelp centertilda
https://docs.oracle.com/en/cloud/get-started/subscriptions-cloud/get-trial-or-subscription.html
Manage Oracle Cloud Accounts and Services - Sign Up for a Free Credit Promotion or a new Cloud...
Documentation that describes how to get started with a metered or non-metered subscription to a service or request a trial or free credit promotion.
accounts and servicessign up fororacle cloudfree creditmanage
https://fondyflow.io/onboarding/
Sign in to Fondy Flow | Manage your Business Accounts
sign in tomanage your businessfondyflowaccounts
https://incogniton.com/blog/how-manage-multiple-instagram-accounts/
How to Manage Multiple Instagram Accounts - Incogniton
Creating multiple Instagram accounts allows brands to establish their popularity and reach their target audience faster. Manage the accounts with Incogniton.
how tomanagemultipleinstagramaccounts
https://www.bankofamerica.com/online-banking/sign-in/
Log in to Bank of America Online & Mobile Banking to Manage Your Accounts
bank of americalog inmobile bankingyour accountsonline
https://help.zenodo.org/docs/profile/manage-multiple-accounts/
Manage multiple accounts | Zenodo
Zenodo is a free and open digital archive built by CERN and OpenAIRE, enabling researchers to share and preserve research output in any size, format and from...
multiple accountsmanagezenodo
https://danstutorials.com/tutorials/tutor-for-ipad-2/lessons/videos-for-ipados-26/topics/manage-mail-accounts/
Manage Mail Accounts - Dans Tutorials
Mar 18, 2026 - Introduction Your iPad can manage email from multiple services, such as iCloud, Gmail, Outlook, or Yahoo. Each of these is added to the iPad as a mail account,...
managemailaccountsdanstutorials
https://my.wishlistmember.com/
WishList Member Accounts – Manage your WishList Member account, subscriptions, downloads, and more!
manage your accountwishlist memberand moreaccountssubscriptions
https://www.chase.com/personal/mortgage/manage-account
Manage Your Mortgage or Home Equity Accounts | Chase
Find out the different ways you can manage your mortgage or home equity accounts at Chase
manage your mortgagehome equityaccountschase
https://octobrowser.net/solutions/ecommerce/
Manage multiple accounts on marketplaces and increase sales efficiency — Octo Browser
Increase your sales efficiency by creating large brand networks on the biggest e-commerce marketplaces. The number of accounts is unlimited.
multiple accountsincrease salesmanagemarketplacesefficiency