https://ditchthecarbs.buzzsprout.com/share
Feel Better. Live Free. | Healthy Weight Loss & Wellness for Midlife Women
healthy weight lossfeelbetterlivefree
https://lizearlemasterclass.teachable.com/p/midlife-nutrition
Are You Getting Enough? The ABCs of Midlife Nutrition with Liz Earle
Midlife doesn’t have to feel like a guessing game. Hormones shift, energy changes and suddenly the skin, sleep, and mood you once took for granted can feel...
liz earlegettingenoughabcsmidlife
https://www.thecut.com/article/midlife-quiet-divorce.html
How Some Midlife Women Are Quietly Quitting Their Husbands
Nov 24, 2025 - Rather than deal with the inconveniences of divorce — the paperwork, the math, the pitying looks — more and more women over 40 are choosing to just check out.
midlifewomenhusbands
https://www.buzzsprout.com/2318440_
The Intentional Midlife Mom Podcast | Simple, Practical Life, Home & Mindset Solutions for Moms...
Welcome to The Intentional Mom™ Podcast, where we provide simple, practical solutions for women over 40 and over 50 who are feeling lost in their lives as...
practical lifesolutions forintentionalmidlifemom
https://www.latimes.com/entertainment-arts/books/story/2026-02-13/emily-nemens-clutch-novel-interview-midlife-friendship
Emily Nemens on midlife, friendship and her new novel 'Clutch' - Los Angeles Times
Feb 13, 2026 - The former Paris Review editor discusses why being 40 in the 2020s feels more uncertain than ever and how her new novel explores the
los angeles timesemilymidlifefriendshipnew
Sponsored https://fantasy.ai/
Create, Chat, and Connect with Your Perfect AI Companion - Fantasy.ai
Upgrade your Fantasy with a next-level AI Companion Platform. Create, Chat, and Connect. Your Fantasy, your Way!
https://www.theepochtimes.com/health/4-habits-that-make-a-difference-in-cognitive-decline-6001655
Your Brain Is Flexible in Midlife: 4 Habits to Prevent Decline | The Epoch Times
Apr 16, 2026 - Two brain experts say midlife is a critical window for brain health.
the epoch timesbrainflexiblemidlifehabits
https://reportcard.meawisdom.com/
Midlife Report Card
I just completed my Midlife Report Card with MEA, and the results were eye-opening! 🙌 It’s a great way to check in on where I’m thriving and where I could use...
report cardmidlife
https://www.mavenclinic.com/programs/menopause
Maven Menopause & Midlife Health | Expert menopause and midlife education, health, and care
mavenmenopausemidlifehealthexpert
https://www.channelnewsasia.com/today/ground-up/millennial-mid-life-crisis-young-adult-mental-health-emotional-turmoil-social-media-age-5922521
Why the midlife crisis for millennials looks different in Singapore - CNA
Feb 14, 2026 - Every generation has its own version of the midlife crisis, but millennials and experts tell CNA TODAY that the scale and complexity of the angst that adults...
midlife crisismillennialslooksdifferentsingapore
https://girlfriend.aarp.org/relationships/divorce/
Divorce Advice & Articles: Navigating Midlife Splits
Jan 26, 2026 - Explore our collection of articles on navigating divorce in midlife. Find expert advice, legal tips, and stories to help you move forward.
divorce advicearticlesnavigatingmidlifesplits
https://www.jessikafruchtermft.com/
Perimenopause and Midlife Therapy Oakland CA | Jessika Fruchter, LMFT
Holistic therapy for perimenopause and midlife women in Oakland, California and online across CA. Support for anxiety, mood swings, and feeling unlike yourself.
oakland caperimenopausemidlifetherapyjessika
https://blogs.webmd.com/skin-care/20250922/brows-in-midlife-what-to-know-about-microblading-ombre-and-tattooing
Brows in Midlife: What to Know About Microblading, Ombre, and Tattooing
If you’ve noticed your brows looking thinner, sparser, or just not what they used to be, you’re not imagining it ....
what to knowbrowsmidlifemicrobladingombre
https://www.independent.ie/podcasts/the-big-tech-show/the-big-tech-show-the-jeff-bezos-story-from-billionaire-amazon-founder-to-midlife-crisis-to-space-missionary/a566945605.html
The Big Tech Show - The Jeff Bezos story: from billionaire Amazon founder to midlife crisis to...
Jan 13, 2026 - What makes Jeff Bezos tick? Is he a generational talent who will take us to the stars? Or billionaire tech bro living the high life?
big techjeff bezosmidlife crisisshowstory
https://www.self.com/story/midlife-crisis-having-it-all
How I Turned My Midlife Crisis Into a Second Chance | SELF
Nov 20, 2025 - Letting go of “having it all” was the best decision I ever made.
a second chancemidlife crisisturnedself
https://www.midlifedivorcerecovery.com/
Midlife Divorce Recovery | Helping Heal & Overcome Divorce
Sep 6, 2024 - Christian Divorce Recovery
midlifedivorcerecoveryhelpingheal
https://fetish-games.com/tag/the_midlife_adventurer/
the_midlife_adventurer - Porn Games Zone: Best Sex Games & Adult Games
porn gamesbest sexmidlifeadventurerzone
https://www.theflowspace.com/p/the-sex-and-relationships-issue-cover-story/
Kristin Davis Discusses Dating and Relationships in Midlife
Kristin Davis talks about her journey with dating, the reception to And Just Like That and what she hopes for the future.
dating and relationshipskristin davismidlife
https://www.nme.com/reviews/tv-reviews/vladimir-review-rachel-weisz-leo-woodall-3932733
'Vladimir' review: steamy midlife crisis comedy is loads of fun
Rachel Weisz is very much mad about the boy (Leo Woodall) in Netflix's steamy midlife crisis comedy drama 'Vladimir'
loads of funmidlife crisisvladimirreviewsteamy
https://www.authentichappiness.sas.upenn.edu/news/listen-npr-radio-forum-meeting-challenges-midlife
Listen to NPR Radio Forum on Meeting the Challenges of Midlife | Authentic Happiness
authentic happinesslistennprradioforum
https://www.theglobeandmail.com/opinion/article-midlife-isnt-a-crisis-its-a-compression/
Midlife isn’t a crisis, it’s a compression - The Globe and Mail
Apr 24, 2026 - Like the narrow rings of a tree during lean years, this dense period of life is more about perseverance than expansion
globe and mailmidlifecrisiscompression
https://lewdflix.com/game/midlife-crisis/
Midlife Crisis - Lewdflix | Play Porn Games
Apr 16, 2026 - You take on the role of a successful middle aged man who is starting to feel the years slip by. Maybe the new college students you and your wife have allowed
play porn gamesmidlife crisislewdflix
https://sciencedaily.com/releases/2026/04/260407073850.htm
Your vitamin D levels in midlife could shape your brain decades later | ScienceDaily
Vitamin D levels in midlife may play a bigger role in long-term brain health than previously thought. In a study following nearly 800 people over 16 years,...
vitamin dlevelsmidlifecouldshape
https://utahstatemagazine.usu.edu/education/midlife-makeover-pressured-by-a-changing-industry-one-aggie-decided-to-chase-a-dream/
Midlife Makeover: Pressured by a Changing Industry, One Aggie Decided to Chase a Dream - Utah State...
Jan 23, 2026 - By Nadia Pflaum | Photos by Levi Sim Dave Foster has worked many different jobs in his 44 years. For […]
utah statemidlifemakeoverchangingindustry
https://www.japantimes.co.jp/life/2026/02/20/digital/game-pokemon-anniversary-nintendo/
Japan’s gaming icons are getting midlife makeovers as they hit their 40s - The Japan Times
Feb 21, 2026 - Zelda, Pokemon, Dragon Quest and more mark major anniversaries in 2026 — a milestone year for the industry they built.
the japan timesgamingiconsgettingmidlife
https://the-leap.webflow.io/
Gap Year, Midlife, School & Corporate Volunteer Programmes Abroad | The Leap
Join our volunteering adventure programmes in Africa, Asia, and South America. Combine planet-protecting projects with team travel for meaningful experiences...
gap yearcorporate volunteerthe leapmidlifeschool
https://girlfriend.aarp.org/relationships/friendship/how-i-found-friends-in-the-strangest-of-places/
Here's How To Make Friends In Midlife In A New City
I was in a new city at age 55. Here's what I did.
how to makenew cityfriendsmidlife
https://www.prweb.com/releases/thirtyfivesixtyfour-podcast-launches-expert-driven-midlife-womens-health-series-302634463.html
ThirtyFiveSixtyFour Podcast Launches Expert-Driven Midlife Women's Health Series
Dec 7, 2025 - /PRNewswire-PRWeb/ -- One of the leading voices in the series is Dr. Betsy Greenleaf, the nation's first female board-certified urogynecologist and founder...
health seriespodcastlaunchesexpertdriven
https://www.businessinsider.com/megan-roup-midlife-fitness-program-women-2026-3
Sculpt Society Expands to Offer Midlife Support - Business Insider
Apr 6, 2026 - The Sculpt Society launched an app in 2019. The company offers 1,000 on-demand classes and specialized programs for bridal, prenatal, and more.
support businesssculptsocietyexpandsoffer
https://www.theflowspace.com/interpersonal-health/relationships/boost-libido-tips-midlife-2990198/
8 Tips to Boost Libido for Busy Midlife Couples
Apr 27, 2026 - One way to get yourself ready for intimacy is trying these
tipsboostlibidobusymidlife
https://www.theflowspace.com/lists/best-sexy-gifts-for-women-midlife/
The 13 Best Sexy Gifts For Women in Midlife
The best sexy gifts for midlife women include everything from books and erotica subscriptions to vibrators and arousal oil. Shop experts' picks ahead!
gifts for womenbestsexymidlife
https://www.helpguide.org/aging/healthy-aging/midlife-crisis
Midlife Crisis: Signs, Causes, and Coping Tips – HelpGuide.org
Feb 19, 2026 - Feeling dissatisfied with your life in middle age? Learn about the signs of a midlife crisis, the causes, and how to find peace in this stressful stage of life.
midlife crisissignscausescopingtips
https://karenmartel.com/
Perimenopause & Menopause Support | Karen Martel – Midlife Solutions
menopause supportperimenopausekarenmidlifesolutions
https://blogs.gnome.org/alatiera/2025/11/06/dhh-and-omarchy-midlife-crisis/
DHH and Omarchy: Midlife crisis – Rust in Peace
Nov 13, 2025 - Couple weeks ago Cloudflare announced it would be sponsoring some Open Source projects. Throwing money at pet projects of random techbros would hardly be news,...
midlife crisisdhhomarchyrustpeace
https://www.theflowspace.com/lists/best-probiotics-middle-age-women/
The 10 Best Probiotics for Midlife Women, According To Experts
The best probiotics for midlife women, from brands like Seed and Ritual, help boost overall health and reduce uncomfortable digestive symptoms.
10 bestaccording toprobioticsmidlifewomen
https://www.businessnewsdaily.com/7123-midlife-career-change.html
Tips for Making a Midlife Career Change - businessnewsdaily.com
Aug 21, 2024 - It's never too late to make a career change. Learn how to take your decades of experience and channel them into a new line of work.
making acareer changetipsmidlife
https://www.theglobeandmail.com/life/first-person/article-what-i-learned-from-my-first-100-days-of-midlife-unemployment/
What I learned from my first 100 days of midlife unemployment - The Globe and Mail
Apr 2, 2026 - This winter was my chance for reflection. What do I want out of the next phase of my life?
first 100 daysglobe and maillearnedmidlifeunemployment
https://www.npr.org/2026/02/09/nx-s1-5611404/new-path-midlife-transformation-wisdom-school
Seeking a new path? A quiz from 'midlife wisdom school' can help : NPR
Feb 9, 2026 - Schools across the country are offering courses and retreats for people 50+ who want to reinvent themselves and embrace lifelong learning and discovery.
a newcan helpseekingpathquiz
https://www.jpmorgan.com/insights/banking/commercial-banking/midi-redefining-midlife-womens-health-care
Midi: Redefining midlife women’s health care
Discover how Midi is revolutionizing women’s health care, with support from the J.P. Morgan Startup Banking team.
health caremidimidlife
https://midlifehealthyliving.com/
Home - Midlife Healthy Living
Oct 30, 2025 - Celebrating the joy of life with food and fun. Weight Watchers Recipes Recipe Collections Midlife Fun Easy Wholesome Recipes Simple, wholesome recipes
healthy livingmidlife
https://www.nationalacademies.org/projects/DBASSE-CPOP-23-01/publication/28909
Identifying Midlife Social Exposures That Might Modify Risks of Cognitive Impairment Associated...
Early life disadvantages have been associated with a higher risk of dementia, but the risk may be modified by early life and midlife exposures. While attention...
cognitive impairmentmidlifesocialmightmodify
https://www.huffingtonpost.co.uk/entry/ageing-exercise-sleep-live-longer_uk_69eb6527e4b08330e41bd145?origin=home-featured-unit
Study Reveals Three Behaviours At Midlife That May Affect How Long You Live | HuffPost UK Life
how longstudyrevealsthreebehaviours
https://www.taboototruth.com/
Intimacy After 50: Real Talk on Midlife Sex and Desire | Taboo To Truth
Mar 26, 2025 - Taboo To Truth helps you understand midlife sex, hormone changes, and desire so intimacy after 50 feels easier, clearer, and more fulfilling.
real talkintimacymidlifesexdesire
https://blogs.webmd.com/skin-care/20251224/topical-estrogen-for-perimenopausal-skin-what-women-in-midlife-should-know
Topical Estrogen for Perimenopausal Skin: What Women in Midlife Should Know
Many women in their 40s and 50s notice significant changes in their skin, often with little warning. These changes may include increased dryness, a rough or...
topicalestrogenskinwomenmidlife
https://www.theflowspace.com/reproductive-health/menopause/menopause-gap-women-of-color-3020400/
The Menopause Gap: How Women of Color Are Underserved in Midlife
Jan 21, 2026 - A new survey, exclusively obtained by Flow Space, finds that women of color face disproportionate barriers to equitable care in midlife.
women of colormenopausegapunderservedmidlife
https://www.everydayhealth.com/emotional-health/the-gen-x-mid-life-crisis-why-its-unique-and-sleepless/
The Female Gen-X Midlife Crisis
Dec 12, 2023 - Women in their forties and fifties are suffering with a unique brand of midlife crisis that’s left them burnt-out and self-doubting, according to Ada Calhoun,...
gen xmidlife crisisfemale
https://link.springer.com/article/10.1186/s12872-026-05762-4?error=cookies_not_supported&code=5bf6aebb-9894-467b-bd8d-3b7108ccd931
Sleep timing irregularity in midlife: association with incident major adverse cardiac events and...
Mar 24, 2026 - Sleep timing reflects daily routines and lifestyle patterns, which influence cardiovascular health through circadian mechanisms that regulate cardiovascula
sleeptimingmidlifeassociationincident
https://www.br.de/radio/podcasts/die-loesung-der-psychologie-podcast/midlife-crisis-sinnsuche-in-der-lebensmitte-und-was-dir-in-der-krise-hilft-100.html
Die Lösung - der Psychologie-Podcast: Midlife-Crisis | Sinnsuche in der Lebensmitte und was dir in...
Apr 23, 2026 - Die Lösung schaltet in den Krisenmodus, diesmal zur Midlife-Crisis und der Frage, warum die Suche nach Sinn vor allem in der Lebensmitte so wichtig wird.
midlife crisisdiederpsychologiepodcast
https://www.psychologytoday.com/us/basics/mid-life
Midlife | Psychology Today
Nov 13, 2025 - Midlife or middle age is that transitional period of life between young adulthood and old age. Middle-aged people often undergo significant changes in their...
psychology todaymidlife
https://sexgamesclub.com/midlife-crisis
Midlife Crisis [v 0.35.2] :: SexGamesClub
midlife crisissexgamesclub
https://mostrecommendedbooks.com/series/midlife-mayhem-books-in-order
All 7 Midlife Mayhem Books in Order (Complete List 2026)
Complete list of the Midlife Mayhem series. Discover all books in this series and find your reading path.
books in ordercomplete listmidlifemayhem
https://www.thecut.com/tags/the-midlife-divorce/
The Midlife Divorce - The Cut
See an archive of all the midlife divorce stories published on The Cut
midlifedivorcecut
https://www.nzherald.co.nz/lifestyle/the-relationship-between-menopause-and-midlife-weight-gain-the-little-things/LNOHHH3DLJAZRLNDL5NGZ2VBPQ/
The relationship between menopause and midlife weight gain – The Little Things - NZ Herald
Apr 10, 2026 - Menopause is often blamed for midlife weight gain, but new global guidance suggests the reality is more complicated. Speaking to Louise Ayrey and Francesca...
weight gainlittle thingsrelationshipmenopausemidlife
https://toyl-midlife-beauty-course.teachable.com/l/products
The Ultimate Midlife Beauty Course
Browse the The Ultimate Midlife Beauty Course product catalog to explore and discover available products.
ultimatemidlifebeautycourse
https://www.huffingtonpost.co.uk/entry/ageing-exercise-sleep-live-longer_uk_69eb6527e4b08330e41bd145?origin=top-ad-recirc
Study Reveals Three Behaviours At Midlife That May Affect How Long You Live | HuffPost UK Life
how longstudyrevealsthreebehaviours
https://www.theleap.co.uk/
Gap Year, Midlife, School & Corporate Volunteer Programmes Abroad | The Leap
Join our volunteering adventure programmes in Africa, Asia, and South America. Combine planet-protecting projects with team travel for meaningful experiences...
gap yearcorporate volunteerthe leapmidlifeschool
https://www.wbur.org/cognoscenti/2026/04/17/men-midlife-and-friendship-running-boston-marathon-mike-dlott
Finding running again in midlife helped me find my people, too | Cognoscenti
find myfindingrunningmidlifehelped
https://institute.mindbodygreen.com/events/nutrition-perimenopause
The Midlife Health Reset: Perimenopause, Nutrition & Longevity | mindbodygreen
How is this different from other nutrition or menopause programs? Who teaches each course, and what does the curriculum include? Learn more in this event!
midlifehealthresetperimenopausenutrition
https://personaltao.com/
Tao of Personal Growth. Exploring Relationships, Midlife and Social Grace
personal growthtaoexploringrelationshipsmidlife
https://midlifemeltoff.fairlady.com/
Home - FAIRLADY HOT Midlife Melt-Off
Dec 15, 2025 - Welcome to FAIRLADY’s HOT midlife melt-off! Shedding those extra kilos you somehow picked up around midlife can be challenging and frustrating. We’ve been...
hotmidlifemelt
https://midlifeattheoasis.com/
Midlife at the Oasis - Where living an amazing life never gets old
Where living an amazing life never gets old
the oasismidlifelivingamazingnever
https://www.bklynlibrary.org/calendar/midlife-momentum-and-park-slope-auditorium-20260502-0200pm
Midlife Momentum and Menopause: Energy, Well-Being, & Resilience for Women | Brooklyn Public Library
Join us for a free, interactive session for women navigating midlife and the shifts that come with peri and postmenopause.Take time for yourself, your health,...
brooklyn public librarywell beingfor womenmidlifemomentum
Sponsored https://ourdream.ai/
ourdream.ai | Ultimate Adult AI Playground | Unlimited Chat, Pics, Videos, and more.
The ultimate adult AI playground. Create unlimited dream companions and explore your every desire. Stunning pics, HD videos, unlimited roleplay, and much more...
https://www.lifehack.org/991474/midlife-reset
Midlife Reset: The 5-Domain System for Rebuilding at 45 and 50
Apr 21, 2026 - A midlife reset is not a crisis. It is a proactive rebuild across 5 life domains on your own timeline. Here is the system and the 90-day roadmap.
midliferesetdomainsystemrebuilding
Sponsored https://www.kupid.ai/
Experience the Future of AI Chat with KupidAI
https://www.nzherald.co.nz/lifestyle/how-to-handle-criticism-that-hits-hard-in-midlife-the-little-things/EUKWH4ATPBEEXODMH4SNAOHI64/
How to handle criticism that hits hard in midlife - The Little Things - NZ Herald
Apr 24, 2026 - In midlife, many people are balancing work, family and long-held expectations of themselves. So when criticism lands, it can hit hard. Talking to Francesca...
the little thingshow tohandlecriticismhits
Sponsored https://faphouse.com/
FapHouse: Full-Length Porn Videos & XXX Movies - Download Sex Videos in Full HD and 4K
Watch full-length porn videos and XXX movies from premium producers on FapHouse. Download sex videos featuring the hottest pornstars and kinkiest models!
https://jenmarples.com/reinventing-yourself-at-midlife-with-jennifer-maxwell/
Reinventing Yourself at Midlife with Jennifer Maxwell - Showit Blog
Dec 11, 2023 - Whether you have experienced loss or are just moving into a new phase of your life, it is never too late to reinvent yourself into the person you want to...
jennifer maxwellmidlifeshowitblog
https://www.fitinmidlife.com/
Fit in Midlife by Jason Smith
jason smithfitmidlife
https://debs-world.com/
Deb's World – Midlife – travel, fun and adventure
Midlife - travel, fun and adventure
debworldmidlifetravelfun
https://www.forbesindia.com/article/upfront/brand-connect/breaking-the-silence-how-miror-is-redefining-womens-midlife-healthcare-in-india/2987102/1
Breaking the silence:How Miror is redefining women’s midlife healthcare in India
breakingsilencemidlifehealthcareindia
https://www.theguardian.com/guardian-live-events/2025/nov/05/fit-forever-wellness-for-midlife-and-beyond
Fit Forever: Wellness for midlife and beyond | Guardian Live events | The Guardian
and beyondlive eventsfitforeverwellness
https://www.faz.net/aktuell/stil/leib-seele/kolumnen/midlife-crisis-so-schlecht-wie-mit-40-ging-es-mir-noch-nie-accg-110612566.html
Midlife-Crisis: So schlecht wie mit 40 ging es mir noch nie | FAZ
Jul 30, 2025 - Als unsere Autorin mit der Faust auf eine Autohaube schlug, war nicht nur der Fahrer erschüttert: Woher kam diese unbändige Wut? Und warum hatte sie so viele...
midlife crisiswiemitesmir
https://www.theflowspace.com/lists/best-spring-coats-for-midlife-women/
6 Best Spring Coats for Midlife Women
Transitional weather is here—which means transitional outerwear is a must. Here are the best spring coats to wear this season.
bestspringcoatsmidlifewomen
https://www.aol.com/articles/most-midlife-adults-feel-better-193007002.html
Most midlife adults feel better about their health than they did in their 30s, according to Hone...
Apr 24, 2026 - Hone Health reports most midlife adults feel healthier and more in control of their health compared to their 30s, with proactive health habits and ambitions.
according tomidlifeadultsfeelbetter
Sponsored https://www.blackedraw.com/
BLACKED RAW: Unfiltered Encounters with Powerful Men in 4K
https://sciencedaily.com/releases/2026/03/260325005914.htm
What you do in midlife could reveal how long you’ll live | ScienceDaily
By closely monitoring fish throughout their lives, researchers found that simple behaviors in midlife—like movement and sleep—can predict lifespan. Fish that...
how longmidlifecouldreveallive
https://bestofbestreview.com/awards/mari-vasan-coaching-best-women-s-midlife-coach-in-the-u-s-2024
Mari Vasan Coaching: Best Women’s Midlife Coach in the U.S. 2024
Best of Best Review honors top businesses, products, and individuals worldwide through a selective awards process focused on innovation, quality, and industry...
in themaricoachingbestmidlife