Robuta

https://www.nameshield.com/ Nameshield - Sécurisation de vos noms de domaine stratégiques Jan 23, 2026 - Premier registrar certifié ISO 27001, Nameshield sécurise vos noms de domaine stratégiques et services associés. Découvrez nos solutions. nameshielddevosnomsdomaine https://www.nameshield.com/temoignages/ Nos clients témoignent - Nameshield Jul 29, 2021 - « Nameshield fut en mesure de com­prendre rapi­de­ment la com­plexi­té de notre orga­ni­sa­tion et a été capable de s’a­dap­ter à nos exi­gences spé­ci­fiques.... nos clientsnameshield https://www.nameshield.com/abus/ Signaler un abus - Nameshield Jun 13, 2023 - NAMESHIELD, en confor­mi­té avec la poli­tique de l’ICANN, vous per­met d’agir dans le cas où un nom de domaine, enre­gis­tré chez nous, aurait ser­vi à... signaler un abusnameshield https://w3techs.com/technologies/comparison/em-dotroll,em-nameshield,em-trendmicro Trend Micro vs. DotRoll vs. Nameshield usage statistics, May 2026 W3Techs compares the usage and its trend of Trend Micro and DotRoll and Nameshield on websites trend microusage statisticsvsnameshieldmay https://blog.nameshield.com/blog/2017/07/13/nameshield-first-french-registrar-certified-iso-27001-registrar-activity/ Nameshield: The first French registrar certified ISO 27001 on all its registrar activity -... Mar 19, 2020 - Nameshield is proud to announce its ISO 27001 certification on all its registrar activity, the product of many months of work. the first https://docs.nameshield.net/ Nameshield API Documentation | Nameshield nameshieldapidocumentation https://www.suped.com/compare/skysnag-vs-nameshield Skysnag vs Nameshield DMARC product review - Suped Compare Skysnag and Nameshield DMARC reporting and email security solutions. In-depth analysis of features, UX, support, suitability, and pricing. product reviewskysnagvsnameshielddmarc https://www.nameshield.com/noms-de-domaine/gestion-croisee-marques-et-noms-de-domaine/ Gestion marques et noms de domaine avec la solution Nameshield Aug 18, 2022 - Nameshield a développé pour vous une solution permettant la gestion croisée marques et noms de domaine. En savoir plus sur notre solution. noms de domainela solutiongestionmarqueset https://www.nameshield.com/desinscription-aux-communications/ Désinscription aux communications - Nameshield auxcommunicationsnameshield https://www.suped.com/compare/ondmarc-vs-nameshield OnDMARC vs Nameshield DMARC product review - Suped An in-depth comparison of OnDMARC and Nameshield DMARC reporting platforms, covering features, user experience, support, and pricing. product reviewvsnameshielddmarcsuped https://www.nameshield.com/propriete-intellectuelle/lutte-contre-les-fake-shops/ Luttez contre les Fake Shops avec la solution Nameshield Oct 9, 2025 - Face à la multiplication des Fake shops, découvrez notre solution tout-en-un pour détecter, remédier et prévenir ces menaces. fake shopsla solutioncontrelesavec https://w3techs.com/technologies/comparison/dn-easydns,dn-nameshield,dn-rochen easyDNS vs. Nameshield vs. Rochen usage statistics, May 2026 W3Techs compares the usage and its trend of easyDNS and Nameshield and Rochen on websites usage statisticseasydnsvsnameshieldrochen https://w3techs.com/technologies/comparison/dn-exoscale,dn-nameshield Nameshield vs. Exoscale usage statistics, May 2026 W3Techs compares the usage and its trend of Nameshield and Exoscale on websites usage statisticsnameshieldvsexoscalemay https://www.nameshield.com/en/domain-names-management/new-gtld/ New gTLD - Nameshield new gtldnameshield