https://www.newarka.edu/life-at-na/news/details/~board/school-news/post/2026-national-merit-semifinalists
Newark Academy is proud to announce that nine current seniors were named 2026 National Merit Semifinalists, joining 16,000 students across the country.
national meritninenewarkacademystudents
https://socialprescribingacademy.org.uk/what-is-social-prescribing/social-prescribing-for-older-people/
NASP is here to support healthy ageing through social prescribing. Access resources, case studies, evidence and more
older peoplenational academysocialprescribing
https://www.sportingnews.com/us/high-school/news/national-high-school-girls-basketball-top-25-rankings/0f61dd31d3625ac5dca7dd1a
Archbishop Mitty actually rises after losing to Ontario Christian, and Incarnate Word Academy and Red Bank Catholic debut for pulling some impressive upsets.
high school girlssporting newsnationalbasketballtop
https://socialprescribingacademy.org.uk/what-is-social-prescribing/advice-and-information/
Financial, legal, and other problems have a huge impact on health. Social prescribing offers a way for people to get help with money, debt, housing and more.
national academyadviceinformationsocialprescribing
https://news.mit.edu/2026/mit-community-members-elected-national-academy-engineering-0217
Seven MIT faculty members, along with 12 additional alumni, were elected to the National Academy of Engineering (NAE) for significant contributions to...
mit communitynational academymemberselectedengineering
https://www.massey.ac.nz/about/colleges-schools-and-institutes/college-of-creative-arts/national-academy-of-screen-arts/
Home to New Zealand’s most comprehensive screen arts community, advanced screen technologies and production facilities, and the nation’s leading screen...
national academyscreen artsmasseyuniversity
https://socialprescribingacademy.org.uk/what-we-do/local-communities/
Support for grassroots voluntary, community, faith, and social enterprise groups involved in social prescribing. Working together to help local communities.
local communitiesnational academysocialprescribing
https://now.tufts.edu/2025/10/20/tufts-dean-named-national-academy-medicine
Christina Economos, dean of the Friedman School at Tufts University and an international leader in research into children’s nutrition, health, and obesity...
national academytuftsdeannamedmedicine
https://www.Princeton.EDU/news/2026/01/22/crockett-seung-win-major-prizes-national-academy-sciences
Molly Crockett will receive the 2026 Troland award for early-career researchers in experimental psychology, Sebastian Seung the Pradel award in neuroscience...
national academycrockettseungwinmajor
https://www.nasi.org/board/
Dec 13, 2025 - Paul N. Van de Water Chair Paul N. Van de Water is a Senior Fellow at the Center on Budget and Policy Priorities. He was Vice President for Health Policy at...
national academysocial insuranceboarddirectors
https://www.philadelphiaunion.com/academy/news/union-academy-sees-two-selected-for-us-u-16-national-team-camp
Oct 23, 2025 - All the latest Philadelphia Union news, photos, highlights, stats and tickets.
unionacademyseestwoselected
https://www.udel.edu/udaily/2026/february/abraham-lenhoff-elected-national-academy-of-engineering/
UD chemical engineer honored for advancing protein purification technologies
national academyelectedengineeringudaily
https://www.utsouthwestern.edu/newsroom/articles/year-2025/oct-nam-physiology-chair-molecular-biologist.html
Duojia Pan, Ph.D., Chair and Professor of Physiology at UT Southwestern Medical Center, and Joshua Mendell, M.D., Ph.D., Professor of Molecular Biology, have...
national academyphysiologychairmolecularelected
https://en.acatech.de/academy/
Sep 17, 2025 - 2 acatech ist die von Bund und Ländern geförderte nationale Akademie und Stimme der Technikwissenschaften im In- und Ausland.
academynationalscienceengineering
https://www.nasi.org/2025/10/22/2025-robert-m-ball-award-gala/
Nov 21, 2025 - The National Academy of Social Insurance hosted its annual Robert M. Ball Award gala on Wednesday, October 22, 2025, at The Mayflower Hotel in Washington, D.C....
national academyrobertballawardgala
https://stories.prf.org/nai-stephan-biller/
Feb 11, 2026 - Stephan Biller’s work focuses on manufacturing & operations strategy, smart manufacturing, digital twin, Industry 4.0, and supply chain resiliency.
national academyinventorsfellowspurduestephan
https://www.eventbrite.com/e/guided-tour-of-the-national-academy-of-sciences-building-tickets-1337309321179?aff=NAPAR
Eventbrite - National Academy of Sciences presents Guided Tour of the National Academy of Sciences Building - Friday, May 2, 2025 | Thursday, February 12, 2026...
guided tournational academysciencesbuildingtickets
https://socialprescribingacademy.org.uk/about-us/
The National Academy for Social Prescribing is the charity that champions social prescribing. We want to social prescribing to thrive.
national academyussocialprescribing
https://www.philadelphiaunion.com/academy/news/union-academy-see-four-selected-for-u-s-u-16-national-team-camp
Sep 10, 2025 - All the latest Philadelphia Union news, photos, highlights, stats and tickets.
unionacademyseefourselected
https://www.nasonline.org/
Feb 10, 2026 - The National Academy of Sciences (NAS) is a private, nonprofit organization of the country’s leading researchers, recognizing and promoting outstanding science.
national academysciences
https://www.nae.edu/323085/TsuJae-Liu-Nominated-to-be-Next-National-Academy-of-Engineering-President
NAE members will vote in March 2025 to elect a new NAE president.
naewebsitetsujaeliu
https://news.vt.edu/articles/2025/12/vetmed-research-seleem.html
The Virginia Tech bacteriologist's 21 patents target a global crisis of antimicrobial-resistant infections that kill 1.27 million people annually.
national academymohamedelectedfellowinventors
https://news.unm.edu/news/unm-inventor-eric-prossnitz-named-2025-national-academy-of-inventors-fellow
Eric R. Prossnitz, a distinguished professor at The University of New Mexico, has been named a fellow of the National Academy of Inventors (NAI), the highest...
national academyunminventorericnamed
https://news.ucsc.edu/2025/12/nai-fellows-2025/
Dec 12, 2025 - The recognition is the highest professional distinction awarded to academic inventors.
davidelectedfellowsnational
https://www.colorado.edu/chbe/kristi-anseth-awarded-national-academy-engineerings-founders-award
Distinguished Professor Kristi Anseth, also the associate faculty director of CU Boulder’s BioFrontiers Institute, designs biomaterials that interact...
national academykristiawardedengineeringfounders
https://socialprescribingacademy.org.uk/how-we-can-support-you/social-prescribing-link-workers/
As the charity that champions social prescribing, NASP offers support for link workers . Find resources for social prescribing link workers or contact NASP for...
national academysupportingworkerssocialprescribing
https://bostonbolts.com/boys/national-academy-league/
Sep 19, 2025 - National Academy League ‹ › Boston Bolts National Academy League ID Events give players the opportunity to be identified for one of the top youth...
national academyleaguebostonboltsfc
https://socialprescribingacademy.org.uk/how-we-can-support-you/supporting-you/
How do I access social prescribing? If non-medical problems are affecting your mental and physical health, there are many ways to find help in your community.
national academysupportingsocialprescribing
https://www.philadelphiaunion.com/academy/news/academy-s-matthew-white-selected-for-u-s-u-17-national-team-domestic-identity-camp
Sep 3, 2025 - All the latest Philadelphia Union news, photos, highlights, stats and tickets.
academymatthewwhiteselectedu
https://nae.us8.list-manage.com/subscribe?u=1f970dfd0878373af57d89c69&id=0b3cbbfaea
National Academy of Sciences Email Forms
national academysciences
https://ufhealth.org/news/2021/chair-surgery-uf-college-medicine-elected-national-academy-medicine
Gilbert Rivers Upchurch Jr., M.D., the Edward M. Copeland III and Ann and Ira Horowitz Chair in the University of Florida College of Medicine’s department of…
chairsurgeryufcollegemedicine
https://www.nationalorchestra.be/nl/onderwijs/orchestra-academy
Oct 21, 2025 - De Orchestra Academy biedt studenten van Belgische conservatoria de kans om hun opleiding aan te vullen met professionele orkestervaring bij het Belgian…
orchestraacademybelgiannational
https://socialprescribingacademy.org.uk/our-evidence-and-evaluation-work/
We're building a robust body of evidence to demonstrate the positive impact of social prescribing on our health and wellbeing
national academyevidenceprogrammesocialprescribing
https://www.whitecapsfc.com/news/tokode-nigeria-u17-2025
Aug 26, 2025 - VANCOUVER, BC – Vancouver Whitecaps FC BMO Academy player Kunle Tokode was recently called into camp with Nigeria's U-17 men's national...
whitecaps fcbmoacademyplayercalled
https://theemmys.tv/
Feb 13, 2026 - NATAS Announces New Board of Directors View the release Congratulations James Brown Lifetime Achievement Honoree Click Here to Read More About His Storied...
national academyemmysnatastelevisionarts
https://www.nasonline.org/news/2026_president_and_council_election/
Jan 28, 2026 - WASHINGTON — Neil H. Shubin, Robert R. Bensley Distinguished Service Professor of Organismal Biology and Anatomy and vice dean for academic advancement at the...
national academyneilhelectednext
https://rede.ecu.edu/innovation/national-academy-of-inventors/
Oct 18, 2024 - The National Academy of Inventors was founded in 2010 to recognize and encourage inventors with patents issued from the U.S. Patent and Trademark Office. The...
national academyinventorslicensingampcommercialization
https://www.lagalaxy.com/news/three-la-galaxy-academy-products-called-up-for-u-s-u-17-men-s-national-team-roster-for-friendlies-in-netherlands
Aug 27, 2025 - LA Galaxy Academy products Ryan Hartley, Kike Martinez and Mateo Tsakiris each named to U-17 USMNT roster for international training camp in Netherlands from...
la galaxythreeacademyproductscalled
https://en.academyart.org.ua/
Self-administered scientific organisation in the field of culture and arts, based on state ownership.
national academyartsukraine
https://nam.edu/membership/national-academy-of-medicine-code-of-conduct/
Feb 18, 2025 - Membership in the NAM is a privilege predicated on members’ adherence to ethical standards and professional behavior. Read our code of conduct.
national academymedicinecodeconductnam
https://socialprescribingacademy.org.uk/
NASP is the national charity that champions social prescribing. We support and connect people, communities and organisations so that more people across the UK...
national academysocialprescribing
https://www.philadelphiaunion.com/academy/news/union-academy-duo-selected-for-u-s-u-15-national-team-camp
Oct 17, 2025 - All the latest Philadelphia Union news, photos, highlights, stats and tickets.
unionacademyduoselectednational
https://nationalcentreforwriting.org.uk/academy/
Nov 19, 2025 - NCW Academy creative writing courses, workshops and mentoring are delivered by award-winning tutors, authors and industry experts
academynationalcentrewriting
https://www.imgacademy.com/news/img-academy-baseball-crowned-2023-maxpreps-national-champions-after-undefeated-season
BRADENTON, Fla. (June 12, 2023) – IMG Academy’s National baseball team secured its first MaxPreps Baseball National Championship in program history off the...
img academynational championsbaseballcrownedmaxpreps
https://www.sciencespo.fr/fr/actualites/le-livre-de-william-genieys-distingue-par-la-national-academy-of-public-administration-des-etats-unis/
Un nouveau prix pour « A Government of Insiders. The People Who Made the Affordable Care Act Possible » (John Hopkins University Press, 2024).
national academylelivrewilliampar
https://www.nationaljewish.org/about-us/news/press-releases/2025-news/2025-night-day-golf-classic-raises-funds-for-morgridge-academy-at-national-jewish-health
On May 18 and 19, philanthropic and business leaders came together for the Night & Day Golf Classic, a two-day event raising more than $280,000 to support...
golf classicraises fundsnightampday
https://www.nasi.org/social-security-speakers-bureau/
Dec 2, 2025 - The Social Security Speakers Bureau brings together a diverse array of trusted experts on Social Security from the Academy’s membership. Members of the...
social securityspeakers bureaunational academyinsurance
https://www.holidify.com/places/pune/national-defence-academy-sightseeing-122385.html
Get the best Information about National Defence Academy. Get the latest information and plan your visit to National Defence Academy
national defenceacademypuneindia
https://www.chicagofirefc.com/two/news/chicago-fire-academy-midfielder-oscar-pineda-named-to-mexico-u-17-men-s-national-team-for-2025-fifa-u-17-world-cup
Nov 3, 2025 - The official website of Chicago Fire II, Chicago Fire FC's MLS Next Pro team. Find the latest news, tickets, schedule, scores, stats, and more.
chicago fireacademyoscarpinedanamed
https://www.usf.edu/research-innovation/news/2025/national-academy-of-inventors-welcomes-three-usf-inventors-into-its-2025-class-of-fellows.aspx
University of South Florida
national academyinventorswelcomesthreeusf
https://www.namadr.com/speaking-engagements/video-nam-academy-cle-webinar-best-practices-in-drafting-arbitration-clauses/
Nov 13, 2025 - Arbitration agreements must conform to the interests and needs of the parties. This program will address the various terms that may be considered in drafting a...
best practicesvideonamacademywebinar
https://www.rediff.com/sports/report/gujarat-to-host-reactivated-national-olympic-academy-as-ioa-pushes-reforms/20260112.htm
Jan 12, 2026 - Under Usha and Narang, the National Olympic Academy will 'collaborate' closely with the International Olympic Academy in Olympia, to 'align India's Olympic...
gujarathostreactivatednationalolympic
https://socialprescribingacademy.org.uk/what-we-do/our-workinnovation/
Voluntary organisations exist to make a social impact. To help people live fuller, happier lives. Innovation is a way to support these organisations to...
national academyinnovationsocialprescribing
https://www.nae.edu/345149/NAENewClass2026?layoutChange=LowGraphics
The National Academy of Engineering (NAE) today announced the election of 130 members and 28 international members to its Class of 2026, said NAE President Tsu
national academynaewebsiteengineeringmembers
https://socialprescribingacademy.org.uk/what-is-social-prescribing/social-prescribing-and-long-term-conditions/
Social prescribing has the potential to support patients and the NHS, and support society as a whole, in helping people with long-term conditions
long term conditionsnational academysocialprescribing