Robuta

https://www.packaging-gateway.com/news/eu-legislation-industry-warning/ EU legislation endangers packaging recycling, industry warns Jan 26, 2024 - A coalition of organisations within the packaging value chain has issued a plea to EU legislators, urging the removal of references to 'state-owned producer... eu legislationpackaging recyclingindustrywarns https://www.dashanpacking.com/the-role-of-pet-and-rpet-in-plastic-packaging-recycling-data-from-the-eu-and-california/ The Role Of PET And RPET In Plastic Packaging Recycling: Data From The EU And California Nov 21, 2025 - This article explores the role of plastic packaging, particularly PET and RPET, in food packaging recycling. Using data from the EU and California, it... role ofplastic packagingrecycling datapeteu https://www.plastmagazine.it/packaging-recycling-2025-relatori-contenuti/ Packaging & Recycling 2025: i relatori, i contenuti - Plastmagazine packaging recyclingrelatoricontenuti https://resource-recycling.com/recycling/2019/12/03/a-closer-look-at-container-and-packaging-recycling-rates/ A closer look at container and packaging recycling rates - Resource Recycling Nov 20, 2025 - The recycling rate for containers and packaging was 50.1% in 2017. | Arturs Budkevics/Shutterstock The overall U.S. recycling rate was a closer lookpackaging recyclingcontainerratesresource https://modernplasticstaiwan.com/millad-nx-8000-eco-ready-for-plastic-packaging-recycling/ Millad NX 8000 ECO ready for plastic packaging recycling - Modern Plastics Taiwan Dec 5, 2020 - Millad NX 8000 technology is fully compatible with polypropylene (PP) recycling processes in Europe and poses no recyclability issues, according to RecyClass, for plasticpackaging recyclingnxecoready https://xray.greyb.com/packaging/separation-by-material-type Material Classification for Packaging Recycling Streams Discover techniques for classifying packaging materials to optimize recycling streams, enhancing sustainability and waste reduction efforts. for packagingmaterialclassificationrecyclingstreams https://www.recycling-magazine.com/2026/05/06/bio-based-plastic-packaging/ PPWR report highlights bio-based packaging - RECYCLING magazine May 6, 2026 - A nova-Institute study for the European Commission finds no technical barriers to bio-based plastic packaging and recommends policy targets to support... bio basedpackaging recyclingppwrreporthighlights https://www.plasticsengineering.org/2024/04/invisible-labeling-for-high-quality-packaging-recycling-004556/ Invisible Labeling for High-Quality Packaging Recycling | Plastics Engineering Apr 30, 2024 - The Holy Grail 2.0 initiative led by the AIM-European Brands Association and powered by Digimarc is transforming the recycling landscape. high qualitypackaging recyclingplastics engineeringinvisiblelabeling https://cordis.europa.eu/project/id/816279/fr SMART CONTAINER AND BIG DATA PLATFORM TO INCREASE PACKAGING RECYCLING RATES AND BOOST THE CIRCULAR... ReCircula Solutions has created a platform for the creation of intelligent and easily scalable technological solutions that provide an accessible space for the... big datapackaging recyclingthe circularsmartcontainer https://www.plasticexpert.co.uk/plastic-recycling-news-back-to-mac-cosmetics/ Back to Mac - Packaging Recycling Scheme Feb 2, 2023 - We discuss Mac Cosmetic's 'Back to Mac' packaging recycling scheme. back topackaging recyclingmacscheme https://www.glass-site-services.com/ Packaging & Recycling Services | Glass Site Services Packaging and recycling services. Glass Site Services offers cost effective supply and exceptional levels of service. Quality and Reactivity. packaging recyclingservicesglasssite https://www.witpress.com/elibrary/wit-transactions-on-ecology-and-the-environment/79/14438 Analysis Of The Effect Of The Containers And Packaging Recycling Law On The Waste Management... containers and packagingthe effectwaste managementanalysisrecycling https://chemycal.com/news/f020f420-1e72-4341-81a1-09ee893f1445/Spain_issues_new_regulations_to_promote_plastic_packaging_recycling Spain issues new regulations to promote plastic packaging recycling new regulationsplastic packagingspainissuespromote https://www.daera-ni.gov.uk/consultations/consultation-changes-plastic-packaging-recycling-business-targets-2016-17-and-new-targets-plastic-and-glass-2018-2020 Consultation on changes to the plastic packaging recycling business targets for 2016-17 and new... May 17, 2024 - Consultation on proposals to amend the plastic and glass business recycling targets in the Producer Responsibility Obligations (Packaging Waste) Regulations... to theplastic packagingbusiness targetsconsultationchanges https://www.gpi.org/ Glass Packaging & Recycling | Northern American Glass | GPI Join the glass packaging and recycling coalition to promote glass recycling. Discover the Glass Packaging Institute and the top benefits of recycling glass. glass packagingrecyclingnorthernamericangpi https://www.piovan.com/fr/events/piovan-group-at-packaging-recycling-forum-2022/ PIOVAN GROUP AT PACKAGING & RECYCLING FORUM 2022 - PiovanGroup packaging recyclinggroupforum https://wdi-publishing.com/product/voluntary-producer-responsibility-carton-packaging-recycling-in-u-s/ Voluntary Producer Responsibility: Carton Packaging Recycling in U.S. - William Davidson Institute producer responsibilitycarton packagingwilliam davidsonvoluntaryrecycling https://pmc.ncbi.nlm.nih.gov/articles/PMC8432502/ Recent Advancements in Plastic Packaging Recycling: A Mini-Review - PMC Today, the scientific community is facing crucial challenges in delivering a healthier world for future generations. Among these, the quest for circular and... plastic packagingrecentadvancementsrecyclingmini https://www.wetheitalians.com/news/we-italians-are-leaders-europe-packaging-recycling-and-sustainability-innovations We Italians are leaders in Europe in packaging recycling and sustainability innovations in europepackaging recyclingitaliansleaderssustainability https://campus-fryslan.studenttheses.ub.rug.nl/328/ BARRIERS AND KEY ENABLERS OF ACHIEVING A FIBRE-BASED PACKAGING RECYCLING TARGET OF 90% IN EUROPE -... packaging recyclingbarrierskeyenablersachieving https://www.recyclingproductnews.com/article/33118/latest-terracycle-partnership-to-tackle-hair-care-packaging-recycling Latest TerraCycle partnership to tackle hair care packaging recycling Schwarzkopf, a global leader in hair care solutions, a brand of Henkel, has partnered with international recycling leader TerraCycle to make their... hair carepackaging recyclinglatestterracyclepartnership https://eeco.ro/en/detalii_informatii_despre_sustenabilitate/how-to-correctly-dispose-packaging-for-recycling/ Proper Packaging Recycling: Essential Guide for Sustainability Learn how to correctly recycle packaging and contribute to a cleaner environment. Practical tips to reduce waste and support sustainability in Romania. packaging recyclingfor sustainabilityproperessentialguide https://www.internationalpaper.com/resources/recycling/article/drive-retail-sales-profit-through-sustainable-packaging-recycling Drive Retail Sales & Profit Through Sustainable Packaging & Recycling | International Paper retail salessustainable packagingrecycling internationaldriveprofit https://packagingscotland.com/2025/12/entry-deadline-extended-for-plastics-recycling-awards-europe-2026/ Entry deadline extended for Plastics Recycling Awards Europe 2026 | Packaging Scotland Dec 8, 2025 - THE deadline for entries to the Plastics Recycling Awards Europe 2026 has been extended to 18:00 CET on Friday, 12 December. The seven award categories for ... entry deadlinefor plasticsrecycling awardsextendedeurope https://packaging-journal.de/welt-recycling-tag-2025/ Welt-Recycling-Tag 2025: Fortschritte und Herausforderungen beim Verpackungsrecycling - packaging... Mar 28, 2025 - Am Welt-Recycling-Tag 2025 stehen auch Fortschritte und Herausforderungen beim Verpackungsrecycling im Fokus. weltrecyclingtagfortschritteund https://spnews.com/indo-waste-recycling/ Indo Waste & Recycling 2026 Expo & Forum - Sustainable Packaging News waste recyclingsustainable packagingindoexpoforum https://store.hbr.org/product/mpact-packaging-and-recycling-consumer-pressure-sustainability-and-the-threat-of-plastic-legislation-in-south-africa/UCT019 Mpact packaging and recycling: Consumer pressure, sustainability, and the threat of plastic... Buy books, tools, case studies, and articles on leadership, strategy, innovation, and other business and management topics packaging and recyclingthe threatconsumerpressuresustainability https://www.petnology.com/online/news-detail/erema-recycling-pioneer-faerch-establishes-closed-loop-for-pet-food-packaging EREMA: Recycling pioneer Faerch establishes closed loop for PET food packaging pet food packagingclosed looperemarecyclingpioneer https://nofima.no/publikasjon/10343332/ An Overview of Enhancing Polyolefin Recycling in Food Packaging: Navigating New EU Regulations and... an overviewfood packagingeu regulationsenhancingpolyolefin https://www.packagingdive.com/news/healthcare-plastics-recycling-council-labeling-project/817231/ Next step in recycling more healthcare plastics: Better labeling | Packaging Dive Leaders of a Healthcare Plastics Recycling Council project in 2026 want to empower hospitals to divert more material through clearer, more standardized... next steppackaging diverecyclinghealthcareplastics https://www.interpack.com/en/Media_News/BEVERAGES_PACKAGING/Beverages_Industry_News/New_Enzyme_Improves_PET_Recycling New Enzyme Improves PET Recycling -- interpack 2026 - packaging trade show Find out all the latest news about interpack, the world's leading packaging trade fair, on our comprehensive media and news pages. pet recyclingtrade shownewenzymeimproves https://blog.packagingseller.com/ldpe-resin-recycling-plastic-granulator/ LDPE Resin Packaging Bag Recycling Plastic Granulator Feb 24, 2025 - LDPE Resin Packaging Bag : Our blog provides insights, trends and industry news to help you stay ahead of the curve.... ldperesinpackagingbagrecycling https://www.ecoembes.com/en/the-process-of-recycling-packaging/financing-of-the-recycling-system-for-household-packaging Financing of the Recycling System for Household Packaging | Ecoembes According to Law 11/97 on packaging and packaging waste, which requires packaging firms, distributors, and manufacturers to pay an extra fee to local... household packagingfinancingrecyclingsystemecoembes https://www.enfpaper.com/gspp GS Paperboard & Packaging Sdn. Bhd. - ENF Recycling Directory paperboard packagingrecycling directorygssdnbhd https://businessdailymedia.com/business-news/1781-recycling-is-not-enough-zero-packaging-stores-show-we-can-kick-our-plastic-addiction Recycling is not enough. Zero-packaging stores show we can kick our plastic addiction is notrecyclingenoughzeropackaging https://www.azocleantech.com/news.aspx?newsID=35575 Recycling Textile Waste into High-Strength Packaging Paper Feb 28, 2025 - Innovative techniques at TU Graz allow for the recovery of cotton fibers from textiles, creating stronger paper for packaging and promoting sustainability. textile wastehigh strengthpackaging paperrecycling https://www.braunhousehold.com/en-nz/support/packaging-disposal-and-recycling Packaging Disposal and Recycling | Braun NZ packaging disposalrecyclingbraunnz https://www.sustainabilitymatters.net.au/content/waste/news/waste-survey-finds-gt-80-of-food-packaging-unfit-for-home-recycling-977880746 Waste survey finds 80% of food packaging unfit for home recycling A survey assessing 82 popular food products has found that more than 80% feature packaging that cannot be put into home recycling bins. food packagingfor homewastesurveyfinds https://erp-recycling.org/uk/what-we-cover/services/plastic-packaging-tax/ ERP Plastic Packaging Tax | ERP-Recycling Dec 19, 2025 - To increase the use of recycled material in the production of plastic packaging. The plastic packaging tax will encourage businesses to plastic packaging taxerprecycling https://www.dssmith.com/ DS Smith – Packaging, Paper, Recycling DS Smith is an international packaging company, offering sustainable, plastic-free packaging, integrated recycling services, and sustainable paper products. ds smithpackaging paperrecycling https://exactitudeconsultancy.com/request-customization/53750 Request Customization - Global Packaging Glass Recycling Market Research Report By Product Type... The Packaging Glass Recycling Market Is Set To Grow At An Estimated CAGR Of 4.4% From 2025 To 2034, Rising From $12 Billion In 2024 To $18 Billion By 2034. market research reportby product typerequest customizationglass recyclingglobal https://knowledgenavigator.pwc.com/vat-uk/news/new-hmrc-plastic-packaging-tax-consultation-on-chemical-recycling/ New HMRC Plastic Packaging Tax consultation on chemical recycling plastic packaging taxchemical recyclingnewhmrcconsultation https://nuffoodsspectrum.in/2022/10/19/sidel-opens-new-hub-to-develop-design-for-recycling-primary-packaging.html/ Sidel opens new hub to develop design for recycling primary packaging - FFOODS Spectrum Oct 19, 2022 - Sidel opens new hub to develop design for recycling primary packaging design for recyclingprimary packagingsidelopensnew https://indiamedtoday.com/carestream-goes-green-with-packaging-and-e-waste-recycling/ Carestream Goes Green with Packaging and E-waste recycling - IndiaMedToday Jun 13, 2019 - In a positive step towards sustainability Carestream Health has adopted the use of corrugated trays for their product CARESTREAM DRYVIEW Laser Imaging Films.... e waste recyclingcarestreamgoesgreenpackaging https://www.primelinepackaging.com/blog/single-stream-recycling/ Single Stream Recycling Paper Handles | Prime Line Packaging Apr 19, 2026 - Paper handles are important when it comes to designing eco-friendly shopping bags for your brand as well as the single-stream recycling process. single stream recyclingprime linepaperhandlespackaging https://www.packaginginsights.com/key-interviews/ai-packaging-design-fiberization-compliance-sustainability.html Packaging Strategy Lab founder: AI drives sustainable design and recycling infrastructure... As regulations like the PPWR evolve and circular design becomes the norm, AI gives designers the agility to test more variables, validate assumptions. packaging strategysustainable designrecycling infrastructurelabfounder https://www.birmingham.ac.uk/news-archive/2022/a-new-supercritical-water-approach-to-recycling-plastic-packaging-waste A new 'supercritical water' approach to recycling plastic packaging waste - University of Birmingham A new 'supercritical water' approach to recycling plastic packaging plastic packaging wasteuniversity of birminghamnewsupercriticalwater https://www.packagingworldinsights.com/industrial-goods/uk-to-start-deposit-return-scheme-in-2025-to-boost-recycling/attachment/uk-to-start-deposit-return-scheme-in-2025-to-boost-recycling-2/ UK to start deposit return scheme in 2025 to boost recycling | Packaging World Insights deposit return schemepackaging world insightsukstartboost https://modernplasticsjapan.com/2023/05/03/starlinger-sustainability-and-recycling-for-woven-plastic-packaging-at-interpack-2023/ Starlinger: Sustainability and Recycling for Woven Plastic Packaging at Interpack 2023 - Modern... May 3, 2023 - The Austrian machinery supplier will be showing its solutions for the sustainable use of plastic packaging at interpack 2023. sustainability and recyclingplastic packagingwoveninterpackmodern