Robuta

https://swap-failed.github.io/ Swap Failed on Uniswap or PancakeSwap – How to Fix It (2026) how to fix iton uniswap https://phishdestroy.io/domain/dreptrade.com/ High-Risk Crypto Drainer Domain Dreptrade.com Mimics PancakeSwap May 14, 2026 - Dreptrade.com poses a serious crypto theft risk by impersonating PancakeSwap. Learn how this offline scam site operates and h... Site title: "PancakeSwap". high riskcryptodrainerdomainmimics https://whattofarm.io/pairs/bnb-chain-pancakeswap-rmoon-wbnb-created-2021-04-14 Get live RMOON/WBNB trading pair on PancakeSwap | WhatToFarm $0.0000000006427 RMOON/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $470,453.27 TVL, exchange... getlivewbnbtradingpair https://www.infiniteblocktech.com/pancakeswap-clone PancakeSwap Clone Script | PancakeSwap Clone Development PancakeSwap Clone is a DeFi based Decentralized Exchange platform built using Binance Smart Chain. Avail the world-class services from Infinite Block Tech. pancakeswap clone scriptdevelopment https://whattofarm.io/pairs/bnb-chain-pancakeswap-wildfire-wbnb-created-2021-05-09 Get live WILDFIRE/WBNB trading pair on PancakeSwap | WhatToFarm $0.0004295 WILDFIRE/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $56,309.80 TVL, exchange rates,... getlivewildfirewbnbtrading https://docs.pancakeswap.finance/turkish/products/syrup-pool Syrup Pools | Turkish | PancakeSwap syruppoolsturkishpancakeswap https://twojkurs.pl/czym-jest-pancakeswap/ Czym jest Pancakeswap? jestpancakeswap https://glazok.org/obmen/CAKE-/ Обмен PancakeSwap (CAKE) на - лучшие курсы, выгодный обмен PancakeSwap (CAKE) на Мониторинг... Выгодно обменять CAKE на : моментально, без комиссии через автоматический обменник, указаны минимальные суммы в списке обмена валют и с кошельков электронных... pancakeswap cake https://whattofarm.io/pairs/bnb-chain-pancakeswapv-anb-usdt-created-2026-02-06 Get live ANB/USDT trading pair on PancakeSwap V3 | WhatToFarm $0.0189 ANB/USDT current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $691.94 TVL, exchange rates, real-time... getliveanbusdttrading https://cryptorank.io/price/pancakeswap PancakeSwap Price | CAKE Price Today, Live Chart, USD converter, Market Capitalization |... Current PancakeSwap (CAKE) token data: Price $ 1.57, Trading Volume $ 12.29M, Market Cap N/A, Circ. Supply 326.19M, Total Supply 338.64M. Official links to... today livepancakeswappricechartusd https://coinlive.me/pancakeswap-proposes-to-implement-the-vecake-model/ PancakeSwap proposes to put into action the veCAKE model Nov 22, 2023 - The foremost DEX in the BNB chain ecosystem, PancakeSwap, has just acquired new proposals to put into action the veCAKE tokenomics model. pancakeswapproposesputactionmodel https://www.cryptobitten.com/Exchanges/pancakeswapv3-base/ CryptoBitten Cryptocurrency Exchange - Pancakeswap v3 (Base) Cryptocurrency Exchange - Pancakeswap v3 (Base) cryptocurrency exchangepancakeswapbase https://www.bitcoinstart.nl/crypto/cake/ CAKE coin - Wat is PancakeSwap en wat kun je deze crypto? Apr 17, 2023 - Alles wat je moet weten over PancakeSwap en de CAKE coin die daarbij hoort. Is het interessant om te investeren in CAKE crypto? wat iscakecoinenkun https://whattofarm.io/pairs/bnb-chain-pancakeswap-sushi-eth-created-2021-04-23 Get live SUSHI/ETH trading pair on PancakeSwap | WhatToFarm $0.2401 SUSHI/ETH current price is down -3.72% in the last 24-hour with trading volume of $4,437.87. Explore liquidity pool with $51,232.61 TVL, exchange... getlivesushiethtrading https://weissratings.com/en/crypto/coin/cake Summary - PancakeSwap - Weiss Ratings The Weiss crypto rating of PancakeSwap (CAKE) is D+. summarypancakeswapweissratings https://whattofarm.io/pairs/bnb-chain-pancakeswap-mcd-wbnb-created-2021-06-14 Get live MCD/WBNB trading pair on PancakeSwap | WhatToFarm $0.0000000001096 MCD/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $79,008.04 TVL, exchange rates,... getlivemcdwbnbtrading https://exchangewar.info/coinprice?cake_eur CAKE/EUR - PancakeSwap (CAKE) to Euro (EUR) crypto exchanges - Exchange War CAKE/EUR - PancakeSwap (CAKE) to Euro (EUR) exchange list (compare price and volume) - Where to buy/sell PancakeSwap (CAKE) crypto exchangescakeeurwar https://www.kraken.com/nl/features/auto-earn/pancakeswap PancakeSwap Rewards | Verdien tot APY op CAKE Verdien rewards op je CAKE en laat deze portfolio groeien met Kraken. pancakeswaprewardsverdientotapy https://www.currencyconverterx.com/SGD/CKE/1 1 SGD to CKE - Convert $1 Singapore Dollar to PancakeSwap Token Convert 1 SGD to CKE using live Foreign Currency Exchange Rates. $1 Singapore Dollar to PancakeSwap Token conversion online. singapore dollarsgdckeconvertpancakeswap https://www.techzarinfo.com/blogs/pancakeswap-clone-script Pancakeswap Clone Script: How To Build A Dex Like Pancakeswap Explore how to build a DEX like Pancakeswap. Connect with experts to launch a decentralized exchange software like Pancakeswap. pancakeswap clone scripthow to builddexlike https://subquery.network/search-guides/query/pancakeswap-v3-factory-address-bnb-chain pancakeswap v3 factory address bnb chain | Query Answer Direct answer: verify this contract address on the correct chain and only then use it in indexing or application configuration. Query metrics: impressions 34,... factory addressbnb chainpancakeswapqueryanswer https://whattofarm.io/pairs/bnb-chain-pancakeswap-cbc-wbnb-created-2021-06-16 Get live CBC/WBNB trading pair on PancakeSwap | WhatToFarm $0.0000000005982 CBC/WBNB current price is up 0% in the last 24-hour with trading volume of $0.11. Explore liquidity pool with $394,191.18 TVL, exchange rates,... getlivecbcwbnbtrading https://www.daytrader.dk/tag/pancakeswap/ PancakeSwap - Daytrader.dk pancakeswapdaytraderdk https://www.cointr.com/en/blog/articles/what-is-pancakeswap-cake What is PancakeSwap (CAKE)? | CoinTR PancakeSwap (CAKE) is a decentralized exchange operating on the Binance Smart Chain. What is Cake coin? How can it be acquired? Read our article to learn more! what ispancakeswap cake https://fxcryptonews.com/scammers-offer-fake-pancakeswap-airdrop-with-400-cakes/ Scammers Offer Fake PancakeSwap Airdrop with 400 Cakes - FXcrypto News Apr 26, 2021 - PancakeSwap, a decentralized exchange on Binance Smart Chain rapid popularity has caught the attention of unscrupulous participants... scammersofferfakepancakeswapairdrop https://www.coincarp.com/exchange/pancakeswap-v2/ PancakeSwap (V2) Exchange Live Markets, trade volume ,Guides, and Info | CoinCarp guides and infolive marketspancakeswapexchange https://usethebitcoin.com/news-archive/pancakeswap-v3-to-launch-in-april-on-bnb-smart-chain/ PancakeSwap V3 To Launch In April On BNB Smart Chain | UseTheBitcoin PancakeSwap, a decentralized cryptocurrency exchange, has officially announced that its most recent application version, PancakeSwap V3, will be bnb smart chainpancakeswaplaunch https://whattofarm.io/pairs/bnb-chain-pancakeswap-usdt-dogau-created-2026-02-09 Get live DOGAU/USDT trading pair on PancakeSwap | WhatToFarm $0.0003399 DOGAU/USDT current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $250,287.21 TVL, exchange rates,... getliveusdttradingpair https://docs.pancakeswap.finance/portuguese-brazilian/desenvolvimento/smart-contracts/syrup-pools/smartchefinitializable SmartChefInitializable | Portuguese/Brazilian | PancakeSwap portuguese brazilianpancakeswap https://whattofarm.io/pairs/bnb-chain-pancakeswap-pump-wbnb-created-2021-05-09 Get live $Pump/WBNB trading pair on PancakeSwap | WhatToFarm $0.0000004992 $Pump/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $55,576.96 TVL, exchange rates,... getlivepumpwbnbtrading https://smartliquidity.info/2021/05/17/pancakeswap-x-polkamon-syrup-pool/ Pancakeswap x Polkamon Syrup Pool - Smart Liquidity Research May 17, 2021 - Users can now stake CAKE to earn PMON tokens. 21,800 PMON up for grabs for the community. Farming is started on block 7479300 today. Pancakeswap will smart liquiditypancakeswapxsyruppool https://pancakeswap.app/ Aftermarket.com | The domain Pancakeswap.app is for sale! Please feel free to reach out if you have any questions about the purchase, payment options, or the domain name transfer process.This domain name is brought to... the domainaftermarketpancakeswapappsale https://athenecoin.com/tag/avoiding-high-slippage-when-trading-ath-on-pancakeswap/ Avoiding High Slippage When Trading ATH on PancakeSwap Archives - AtheneCoin Avoiding High Slippage When Trading ATH on PancakeSwap avoidinghighslippagetradingath https://kryptokenner.de/coins/pancakeswap-token/kaufen/ PancakeSwap kaufen und verkaufen: Die besten Anbieter im Vergleich (05/2026) PancakeSwap kaufen: Die besten Anbieter im Vergleich (05/2026) kaufen und verkaufendie bestenim vergleichpancakeswap https://cryptogoldplanet.com/top-undervalued-altcoin-pancakeswap-price-prediction-2021/ Top Undervalued Altcoin (PancakeSwap Price Prediction 2021) - CryptoGoldPlanet % Jul 24, 2021 - Everything you are interested in about cryptocurrencies, the latest news, types and where and how to buy cryptocurrencies as well as everything related to... pancakeswap price predictiontopundervaluedaltcoin https://cryptexlock.me/pair/56/0xEf47e66684327d00241d47a1B21882A8b3B66169 CryptEx | Liquidity Lock and Team Tokens Vesting for PancakeSwap, ApeSwap and others Liquidity provider tokens lock. Team tokens vesting. Binance Smart Chain, Avalanche, Fantom, Polyon. PancakeSwap, ApeSwap, Pangolinswap. liquidity lockcryptexteam https://nhancv.com/pancakeswap-uniswapv2-arbitrum-goerli-nitro-rollup-testnet/embed/ Pancakeswap/UniswapV2 Arbitrum Goerli Nitro Rollup Testnet - nhancv's blog pancakeswaparbitrumnitrorolluptestnet https://whattofarm.io/pairs/bnb-chain-pancakeswap-shibahero-wbnb-created-2021-05-16 Get live ShibaHero/WBNB trading pair on PancakeSwap | WhatToFarm $0.00124 ShibaHero/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $57,155.18 TVL, exchange rates,... getlivewbnbtradingpair https://subquery.network/search-guides/query/pancakeswap-v3-quoterv2-address-bsc pancakeswap v3 quoterv2 address bsc | Query Answer Direct answer: verify this contract address on the correct chain and only then use it in indexing or application configuration. Query metrics: impressions 1,... pancakeswapaddressbscqueryanswer https://crypto.news/pancakeswap-v4-rebrands-to-pancakeswap-infinity-with-major-upgrade/ PancakeSwap v4 rebrands to PancakeSwap Infinity with major upgrade Apr 28, 2025 - PancakeSwap has just unveiled "PancakeSwap Infinity," a major rebrand and upgrade to its DEX as CAKE price records a slight 3,5% uptick to infinitypancakeswaprebrandsmajorupgrade https://coinswitch.co/crypto-compare/avnt-cake Compare Avantis (AVNT) Vs PancakeSwap (CAKE) | Crypto Compare | CoinSwitch pancakeswap cakecompareavantisavntvs https://cryptotvplus.com/tag/pancakeswap/ Pancakeswap | CryptoTvplus - The Leading Blockchain Media Firm Making media accessible blockchain mediapancakeswapleadingfirm https://docs.pancakeswap.finance/welcome-to-pancakeswap/about-us/team/become-a-chef/senior-backend-engineer Senior Backend Engineer | PancakeSwap senior backend engineerpancakeswap https://atomicwallet.io/pancakeswap-wallet PancakeSwap Wallet App | Cake Wallet For Desktop And Mobile | Atomic Wallet Dec 18, 2025 - Download Fast And Secure PancakeSwap Wallet App For Mobile - IOS And Android - And Desktop. Buy, Sell And Swap Cake And 1000+ Cryptos In One Secure Crypto... pancakeswap walletfor desktopappmobileatomic https://bitturk.com/guvenli-pancakeswap-cake-cuzdani Güvenli PancakeSwap (CAKE) Cüzdanı - BitTurk.com Güvenli PancakeSwap - CAKE cüzdanı ve PancakeSwap saklamak için detaylı bilgiler. BitTurk'te hesap açıp güvenli PancakeSwap (CAKE) cüzdanı sahibi olmak çok... pancakeswap cake https://vehiclerecordinsight.com/mango-markets-risk-parameters-when-providing-liquidity-on-pancakeswap-v2-via-arculus/ Mango Markets risk parameters when providing liquidity on PancakeSwap (V2) via Arculus -... Apr 14, 2026 - Verify Overly prescriptive custody mandates concentrate power and systemic risk, while permissive regimes invite fraud and fragmentation. For project teams... risk parameters https://whattofarm.io/pairs/bnb-chain-pancakeswap-dragon-wbnb-created-2025-10-23-0xd50_D42 Get live DRAGON/WBNB trading pair on PancakeSwap | WhatToFarm $0.002564 DRAGON/WBNB current price is down -0.19% in the last 24-hour with trading volume of $155.62. Explore liquidity pool with $195,293.84 TVL, exchange... getlivedragonwbnbtrading https://crypto.news/a-rumor-of-a-potential-kilo-ido-on-pancakeswap-debunked-as-a-gas-fee-optimization-update/ A rumor of a potential KILO IDO on PancakeSwap debunked as a gas fee optimization update Mar 27, 2025 - A rumor of a potential KiloEx initial DEX offering on PancakeSwap was debunked after further clarification revealed that the transaction was a gas optimization... https://docs.pancakeswap.finance/earn/earn-faq/liquidity-pool-faq Liquidity Pool FAQ | PancakeSwap liquidity poolfaqpancakeswap https://docs.pancakeswap.finance/portuguese-brazilian/produtos/compartilhamento-de-receita/como-participar Como participar? | Portuguese/Brazilian | PancakeSwap Como participar do compartilhamento semanal de receitas do protocolo como participarportuguese brazilianpancakeswap https://docs.pancakeswap.finance/welcome-to-pancakeswap/about-us/team/become-a-chef/qa-engineer QA Engineer | PancakeSwap qa engineerpancakeswap https://unocrypto.com/pancakeswap-announced-broadening-cross-chain-swap-feature-to-solana/ PancakeSwap Announced Broadening Cross-Chain Swap Feature To Solana - UnoCrypto Sep 22, 2025 - PancakeSwap has added Solana ($SOL) to its Cross-Chain Swap feature, allowing users to transact across seven blockchains in one interface. The move enhances... cross chain swappancakeswapannouncedfeaturesolana https://forum.pancakeswap.finance/c/gauges/6 Latest Gauges topics - PancakeSwap All discussion about gauges will happen in this Category, including enabling, modifying, and disabling gauges. latestgaugestopicspancakeswap https://skylock.xyz/safeharbor/database/pancakeswap PancakeSwap - Safe Harbor Database safe harborpancakeswapdatabase https://cryptexlock.me/pair/56/0x9D2918dbF9C1255426B085Bd8B654560CAa2bC17 CryptEx | Liquidity Lock and Team Tokens Vesting for PancakeSwap, ApeSwap and others Liquidity provider tokens lock. Team tokens vesting. Binance Smart Chain, Avalanche, Fantom, Polyon. PancakeSwap, ApeSwap, Pangolinswap. liquidity lockcryptexteam https://smartliquidity.info/2021/05/25/pancakeswap-syrup-pool-with-cyclone-protocol/ Pancakeswap Syrup Pool with Cyclone Protocol - Smart Liquidity Research May 25, 2021 - CYC Syrup Pool is now Live! Users can now stake CAKE to earn CYC tokens. 275 CYC up for grabs for the community. Farming is started on block 7683700 and smart liquiditypancakeswapsyruppoolcyclone https://whattofarm.io/pairs/bnb-chain-pancakeswap-usdt-fc-created-2025-11-04 Get live FC/USDT trading pair on PancakeSwap | WhatToFarm $0.01462 FC/USDT current price is down -0.12% in the last 24-hour with trading volume of $179.21. Explore liquidity pool with $538,849.83 TVL, exchange rates,... getlivefcusdttrading https://evalogan786.codeberg.page/mudra/ How to Avoid Rug Pulls: Lock Liquidity on PancakeSwap for Free how to avoidrugpulls https://realacademy.io/index.php/2024/02/08/staking-on-pancakeswap/ Staking on Pancakeswap - Real Crypto Academy Feb 8, 2024 - Staking on PancakeSwap is a simple and rewarding way to earn tokens by supporting the multichain DEX. You just need to deposit some tokens in a pool of your... stakingpancakeswaprealcryptoacademy https://docs.floki.com/floki-whitepaper/exchanges/pancakeswap PancakeSwap | Floki Whitepaper In pancakes we trust pancakeswapflokiwhitepaper https://wybierz.to/kryptowaluta/pancakeswap/ Aktualny kurs, podstawowe informacje o PancakeSwap podstawowe informacjekurspancakeswap https://numbersprotocol.io/blog/investigation-report-for-low-liquidity-in-pancakeswap-at-listing/ Investigation Report For Low Liquidity In Pancakeswap At Listing - Numbers Protocol Dec 13, 2021 - KuCoin will be releasing a compensation plan for all affected users shortly. investigation reportlowliquidity https://sdk.docs.almanak.co/api/connectors/pancakeswap_perps.html PancakeSwap Perps - Almanak SDK Python SDK for developing and deploying autonomous DeFi agents pancakeswapperpsalmanaksdk https://docs.pancakeswap.finance/~/revisions/4JQRJCuMPHEJgYdxdVME/trade/stableswap/classic-stableswap Classic StableSwap | PancakeSwap classicpancakeswap https://www.webseobacklink.com/top-pancakeswap-clone-script-development-build-your-defi-platform/ Top PancakeSwap Clone Script Development | Build Your DeFi Platform - Web SEO Backlink Sep 17, 2024 - Partner with the best PancakeSwap clone script development company to create your own decentralized exchange. Our customizable clone script includes liquidity pancakeswap clone scriptdevelopment build https://whattofarm.io/pairs/bnb-chain-pancakeswap-moonstar-wbnb-created-2021-04-03 Get live MOONSTAR/WBNB trading pair on PancakeSwap | WhatToFarm $0.000000001303 MOONSTAR/WBNB current price is down -0.89% in the last 24-hour with trading volume of $615.30. Explore liquidity pool with $1,673,425.61 TVL,... getlivemoonstarwbnbtrading https://www.bitrue.com:443/price/cake PancakeSwap (CAKE) Price Today: CAKE Live Price Charts, Market Cap & Trends PancakeSwap price today with live CAKE price, 24h change, market data, and price movement overview. pancakeswap caketoday livemarket cappricecharts https://whattofarm.io/pairs/bnb-chain-pancakeswap-afi-wbnb-created-2021-05-18 Get live AFI/WBNB trading pair on PancakeSwap | WhatToFarm $0.0002895 AFI/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $93,229.53 TVL, exchange rates,... getliveafiwbnbtrading https://changelly.com/exchange/xmr/cake Swap XMR to CAKE - Convert & Exchange Monero to PancakeSwap Instantly with Low Fees Exchange Monero to PancakeSwap with beneficial rate using our website or app ✔️ Fast transactions XMR to CAKE exchange with low fee 💲 Choice between 1000+... swap xmrexchange monero https://docs.pancakeswap.finance/welcome-to-pancakeswap/vecake-sunset/bcake/v2-deprecated V2 (deprecated) | PancakeSwap deprecatedpancakeswap https://cryptoofficiel.com/pancakeswap/ PancakeSwap (CAKE) Price Predictions 2026, 2027 & 2030 | Realistic Outlook - CryptoOfficiel Apr 18, 2026 - Explore PanCakeSwap (CAKE) price predictions for 2026, 2027, and 2030 with monthly analysis for 2026 backed by leading sources. pancakeswap cakeprice predictionsrealisticoutlook https://whattofarm.io/pairs/bnb-chain-pancakeswap-usdt-pbk-created-2025-09-30 Get live PBK/USDT trading pair on PancakeSwap | WhatToFarm $1.32 PBK/USDT current price is down -4.30% in the last 24-hour with trading volume of $9,341.16. Explore liquidity pool with $86,015.38 TVL, exchange rates,... getlivepbkusdttrading https://whattofarm.io/pairs/bnb-chain-pancakeswap-evoc-wbnb-created-2021-10-06 Get live EVOC/WBNB trading pair on PancakeSwap | WhatToFarm $0.00004044 EVOC/WBNB current price is up 0% in the last 24-hour with trading volume of $0.00. Explore liquidity pool with $49,942.91 TVL, exchange rates,... getliveevocwbnbtrading https://letstalkbitco.in/pancakeswap-burns-19m-in-cake-tokens-can-it-reverse-32-price-drop/ PancakeSwap Burns $19M in CAKE Tokens: Can It Reverse 32% Price Drop? - Let's Talk, Bitcoin Jan 14, 2025 - PancakeSwap Burns $19M in CAKE Tokens Amidst Market Challenges PancakeSwap, a leading decentralized exchange (DEX), recently destroyed 8.95 million CAKE tokens... https://easyswap.me/crp-na-pancakeswap.html Exchange Crypton (CRP) for PancakeSwap in one move exchangecryptoncrppancakeswapone https://cryptexlock.me/pair/56/0x38B5ca26cFA6a771f7cF6908d780F69EC3297c9C CryptEx | Liquidity Lock and Team Tokens Vesting for PancakeSwap, ApeSwap and others Liquidity provider tokens lock. Team tokens vesting. Binance Smart Chain, Avalanche, Fantom, Polyon. PancakeSwap, ApeSwap, Pangolinswap. liquidity lockcryptexteam https://stockapps.com/blog/lucky-block-now-available-on-pancakeswap/ Lucky Block Lists on PancakeSwap After Pre-Sale Sold Out - StockApps sale sold outlucky blocklistspancakeswap https://thecryptotwist.com/pancakeswap-announced-as-secondary-exhibition-sponsor-at-hong-kong-web3-festival-2026/ PancakeSwap Announced as Secondary Exhibition Sponsor at Hong Kong Web3 Festival 2026 |... exhibition sponsor https://www.finst.com/nl/crypto/pancakeswap PancakeSwap kopen (CAKE) met iDEAL-Wero, Bancontact of SEPA | Veilig en goedkoop | Finst Veilig en snel PancakeSwap kopen ✓ Ultra-lage fees: 0,15% ✓ 340+ coins ✓ Staking ✓ Betalen via iDEAL-Wero ✓ Ontdek ook onze crypto bundels! https://docs.pancakeswap.finance/french/products/pancakeswap-exchange/limit-orders/limit-orders-faq Limit Orders FAQ | French | PancakeSwap limit ordersfaqfrenchpancakeswap https://thecryptofintech.com/pancakeswap-announced-as-secondary-exhibition-sponsor-at-hong-kong-web3-festival-2026/ PancakeSwap Announced as Secondary Exhibition Sponsor at Hong Kong Web3 Festival 2026 |... exhibition sponsor https://whattofarm.io/pairs/bnb-chain-pancakeswapv-xrp-usdt-created-2023-07-09 Get live XRP/USDT trading pair on PancakeSwap V3 | WhatToFarm $1.38 XRP/USDT current price is down -1.13% in the last 24-hour with trading volume of $152,345.98. Explore liquidity pool with $1,369,601.14 TVL, exchange... xrp usdtgetlivetradingpair