Robuta

https://www.tellerstech.com/ DevOps Training & Platform Engineering | Teller's Tech Jan 25, 2026 - Learn DevOps and platform engineering from industry experts. Hands-on training, workshops, and courses in Terraform, Kubernetes, and AWS. Start your journey... devops trainingplatform engineeringtellertech https://www.openempower.com/ AI Platform Engineering for Regulated Enterprises | Open Empower Enterprise AI platform engineering for regulated industries. EU AI Act, DORA, GDPR and NIS2 aligned. Senior-led, fixed scope, evidenced outcomes. ai platform engineeringregulated enterprisesopenempower https://platformcon.com/ PlatformCon 2026 | The #1 platform engineering event PlatformCon is the world’s largest platform engineering conference. Join us for a full week of programming featuring 150+ curated talks and 30+ hours of... platform engineeringplatformconevent https://weaveintelligence.io/ Independent platform engineering research | Weave Intelligence Weave Intelligence combines a team of senior analysts with industry experts and enterprise leaders to produce the leading research on Platform Engineering. platform engineeringindependentresearchweaveintelligence https://www.wearelegence.com/ Legence | Building Performance Platform | Engineering, HVAC & Sustainability Solutions | NASDAQ: LGN Legence is the largest pure-play building performance platform — delivering engineering, consulting, installation, and maintenance for mission-critical... building performanceplatform engineeringsustainability solutionshvacnasdaq https://cloudnativedaysitaly.org/talk/composable-platforms-modular-platform-engineering-with-kratix-and-backstage Composable Platforms: Modular Platform Engineering with Kratix and Backstage - Cloud Native Days... Constructing and managing platforms for diverse teams and workloads presents a significant challenge in today's cloud-native environment. This session... modular platform https://buddy.works/ DevOps & Platform Engineering Suite devops platformengineeringsuite https://fractal.cloud/ Fractal Cloud | Platform Engineering for Secure Multi-Cloud Infrastructure Fractal Cloud is a platform engineering solution that enables companies to deliver ready-to-use, secure, and compliant cloud infrastructure by automating... cloud platform engineeringfractalsecuremultiinfrastructure https://itesys.expert/ SAP Technology, SAP Security & Platform Engineering: deine Experten | itesys AG sap technologysecurity platformdeine expertenengineeringag https://events.linuxfoundation.org/kubecon-cloudnativecon-europe/co-located-events/platform-engineering-day/ Platform Engineering Day | LF Events Platform Engineering Day Europe 2026 has officially wrapped! Thank you to all the attendees who joined us. Watch keynotes and all breakout sessions on the CNCF… platform engineering daylfevents https://www.atlanticdynamic.com/index.html Atlantic Dynamic - Platform Engineering Solutions Provider Atlantic Dynamic helps businesses transform how they use technology through platform engineering, cloud infrastructure, AI/ML solutions, and modern development... platform engineeringatlanticdynamicsolutionsprovider https://www.techtarget.com/searchitoperations/tip/Common-platform-engineering-interview-questions 10 common platform engineering interview questions | TechTarget Review these 10 common platform engineering interview questions and answers to ace your interview and land the next role in your IT career. common platforminterview questionsengineeringtechtarget https://aws.amazon.com/marketplace/pp/prodview-minqciezlp3hm AWS Marketplace: Platform Engineering & Cloud-Native Services Accelerate your move to modern infrastructure with Steamhaus. We enable you to deploy and operate scalable, cloud-native workloads on AWS. Our approach... aws marketplaceplatform engineeringcloud nativeservices https://university.platformengineering.org/ Platform Engineering University From foundational concepts to building your first Minimum Viable Platform. From building teams to planning a rollout strategy for an enterprise-grade IDP. This... platform engineeringuniversity https://events.linuxfoundation.org/archive/2025/kubecon-cloudnativecon-europe/co-located-events/platform-engineering-day/ Platform Engineering Day | LF Events Aug 5, 2025 - Platform Engineering Day Europe has officially wrapped! Thank you to all the attendees who joined us. Watch keynotes and all breakout sessions on the CNCF… platform engineering daylfevents https://cloud.google.com/solutions/platform-engineering?authuser=00 What is platform engineering? | Google Cloud Discover how migrating workloads with platform engineering can help boost developer productivity, reliability, and security. what isplatform engineeringgooglecloud https://cosmocode.io/ CosmoCode - Platform Engineering & DevOps: the Practical Way Production-focused tutorials on DevOps, Platform Engineering, Cloud Infra and SDET. Terraform, Playwright, and more. platform engineeringdevopspracticalway https://www.atlassian.com/de/developer-experience/platform-engineering What is Platform Engineering? | Atlassian what isplatform engineeringatlassian https://www.footprintit.net/ Platform Engineering | Cloud and DevOps Consultants | Footprint IT Solutions Enhance your operations with expert Platform Engineering services from Footprint IT Solutions. We are UK-based specialist IT consultants providing innovative... cloud and devopsplatform engineeringconsultantsfootprintsolutions https://www.accenture.com/in-en/careers/jobdetails?id=R00317876_en S&C GN - MC - Industry X - Product & Platform Engineering -Analyst product platform engineeringgnmcindustryx https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/checkin-20130826 Wikimedia Platform Engineering/MediaWiki Core Team/checkin-20130826 - MediaWiki platform engineeringmediawiki corewikimediateamcheckin https://www.the-devops-company.ch/ The DevOps Company – Platform Engineering & Consulting VSHN is The DevOps Company. Platform engineering, DevOps consulting, and 24/7 cloud operations from Switzerland. Consulting from CHF 250/hour or fixed packages. platform engineeringdevopscompanyconsulting https://roosecure.com/ ROO Secure IT Solutions | Cybersecurity, DevSecOps & Platform Engineering Experts ROO Secure IT Solutions delivers Enterprise-grade Cybersecurity, Agentic AI Development, DevSecOps, platform engineering, and penetration testing services... secure itdevsecops platformroosolutionscybersecurity https://www.goldenflag.com/ Golden Flag America - Platform Engineering & AI Solutions Pioneering the future of cloud-native ecosystems with innovative platform engineering and AI-driven solutions. platform engineering aigoldenflagamericasolutions https://koreo.dev/ The platform engineering toolkit for Kubernetes | Koreo Koreo is a new approach to Kubernetes configuration management empowering developers and platform teams through programmable workflows and structured data the platformengineering toolkitkubernetes https://jobs.siemens.com/fr_FR/externaljobs/JobDetail/495794 Manager, Infrastructure Platform Engineering - Job Detail | Careers Marketplace - Siemens infrastructure platformengineering jobmanagerdetailcareers https://wearemomentum.ai/ Platform Engineering - MomentumAI Our plaform engineering services take your platform to the next level. platform engineering https://www.kubestack.com/ Platform Engineering Framework | Kubestack Kubestack is a Terraform framework for Kubernetes platform engineering teams to define the entire cloud native stack in one Terraform code base and... platform engineeringframework https://www.lnwebworks.com/ AI-Enabled Digital Platform Engineering | LN Webworks Jul 16, 2026 - LN Webworks engineers digital platforms that move businesses forward: modernization, systems integration, and AI automation for SMBs. digital platform engineeringai enabledlnwebworks https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/Site_performance_and_architecture/status Wikimedia Platform Engineering/Site performance and architecture/status - MediaWiki platform engineeringsite performancewikimediaarchitecturestatus https://www.redhat.com/de/blog/whats-difference-between-devops-and-platform-engineering DevOps and Platform Engineering: What's the difference? We hear the terms DevOps and Platform Engineering thrown around as important practices related to modern software development and IT operations. DevOps has... platform engineeringdevopsdifference https://thenewstack.io/platform-engineering/ Platform Engineering Overview, News & Trends | The New Stack Platform engineering is rising in popularity as a sociotechnical discipline in the cloud native world. Learn all about platform engineering here. platform engineeringoverview newstrendsstack https://www.gsi.upm.es/en/investigacion?view=publication&task=show&id=102 Publication - ARIES: a ready for use platform for engineering Spanish-processing tools ready for useplatform engineeringpublicationaries https://jesande.io/ Jesande - Fractional & Interim CTO | Platform Engineering Leader Platform engineering consultancy helping companies build internal developer platforms that multiply engineering team effectiveness. interim ctoplatform engineeringfractionalleader https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/Check-ins/20140211 Wikimedia Platform Engineering/MediaWiki Core Team/Check-ins/20140211 - MediaWiki platform engineeringmediawiki corecheck inswikimediateam https://engineering.fb.com/2016/07/06/connectivity/introducing-opencellular-an-open-source-wireless-access-platform/ Introducing OpenCellular: An open source wireless access platform - Engineering at Meta Jun 26, 2018 - Visit the post for more. open sourcewireless accessplatform engineeringintroducing https://jobs.paloaltonetworks.com/en/job/santa-clara/sr-director-digtial-platform-engineering/47263/93799473392 Sr Director, Digital Platform Engineering at Palo Alto Networks Learn more about applying for Sr Director, Digital Platform Engineering at Palo Alto Networks digital platform engineeringpalo altosrdirectornetworks https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/checkin-20131007 Wikimedia Platform Engineering/MediaWiki Core Team/checkin-20131007 - MediaWiki platform engineeringmediawiki corewikimediateamcheckin https://aws.amazon.com/video/watch/bc4ec7bcfaa/ Platform Engineering with Amazon EKS - AWS Learn best practices for building internal platforms on Amazon EKS to accelerate innovation and improve efficiency. platform engineeringamazon eksaws https://www.mediawiki.org/wiki/Data_Platform_Engineering/Intake_Process Data Platform Engineering/Intake Process - MediaWiki data platform engineeringintake processmediawiki https://thenewstack.io/serving-environments-agent-speed/ Platform engineering's new job: serving environments at agent speed - The New Stack AI coding agents overwhelm environment workflows. Learn how a serving model scales platform engineering for AI-native code velocity. platform engineerings new https://www.puppet.com/resources/2026-state-of-platform-engineering State of DevOps Report: Platform Engineering Edition 2026 | Puppet Read Puppet’s 2026 State of Platform Engineering report, Control at Speed: Platform Engineering in the Age of AI. state ofplatform engineeringdevopsreportedition https://hqhr.com/ HQHR | Technical Recruiting Firm - AI, Platform Engineering & Executive Search ai platform engineeringtechnical recruitingfirmexecutivesearch https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/checkin-20130930 Wikimedia Platform Engineering/MediaWiki Core Team/checkin-20130930 - MediaWiki platform engineeringmediawiki corewikimediateamcheckin https://www.credly.com/badges/7def1f9d-a8ab-4908-a6ab-6cc3a1255f99/public_url CNPA: Certified Cloud Native Platform Engineering Associate - Credly Earners of this designation demonstrated the skills, knowledge and competencies to perform the responsibilities of a Cloud Native Platform Engineering... cloud native platformengineering associatecnpacertifiedcredly https://www.mediawiki.org/wiki/MediaWiki_Platform_team/Simplifying_the_Wikimedia_Foundation_technology_stack Wikimedia Platform Engineering/MediaWiki Platform team/Simplifying the Wikimedia Foundation... platform engineeringwikimediamediawikiteamsimplifying https://www.credly.com/badges/cd769c31-8747-46a9-b6a5-515d0b86dae0 CNPA: Certified Cloud Native Platform Engineering Associate - Credly Earners of this designation demonstrated the skills, knowledge and competencies to perform the responsibilities of a Cloud Native Platform Engineering... cloud native platformengineering associatecnpacertifiedcredly https://platformengineeringisdead.com/ Platform Engineering Is Dead Platform Engineering dreamed big: reusable templates, standards built-in, shiny dashboards. The pitch looked great, but reality hit harder than a Friday deploy. platform engineeringdead https://tidalcommerce.ca/ Digital and Commerce Platform Engineering | Tidal Tidal engineers modern, composable eCommerce platforms and digital solutions that help brands drive growth, agility, and real outcomes. commerce platformdigitalengineeringtidal https://ace.atlassian.com/events/details/atlassian-san-francisco-bay-area-presents-platform-engineering-san-francisco-meetup/ See Platform Engineering - San Francisco Meetup at Atlassian Community Events San Francisco Bay Area Atlassian Community Events San Francisco Bay Area presents Platform Engineering - San Francisco Meetup | Nov 29, 2023. Find event and ticket information. atlassian community eventssee platformsan francisco https://www.computerweekly.com/blog/CW-Developer-Network/Platform-Engineering-Perforce-Puppet-Taming-chaos-in-DevOps-teams Platform Engineering - Perforce Puppet: Taming chaos in DevOps teams This is a guest post for the Computer Weekly Developer Network written by Margaret Lee, manager of product management at Perforce Puppet. The full title of... platform engineeringperforcepuppettamingchaos https://www.novaloop.ch/ Novaloop AG – Software, Platform Engineering & KI aus Zürich Novaloop entwickelt massgeschneiderte Software, betreibt sichere Cloud-Plattformen und berät zu Künstlicher Intelligenz. Persönlich, erfahren, aus Zürich. software platformagengineeringkiaus https://events.linuxfoundation.org/archive/2024/kubecon-cloudnativecon-north-america/co-located-events/platform-engineering-day/ Platform Engineering Day | LF Events Mar 21, 2025 - Platform Engineering Day North America has officially wrapped! Thank you to all the attendees who joined us. Watch keynotes and all breakout sessions on… platform engineering daylfevents https://www.siemens.com/en-us/products/accenture-platform-engineering/ Platform engineering | Siemens Shrinking revenues and cost pressures due to electrification, rising customer and service expectations increase the need for operational efficiency. Enabling... platform engineeringsiemens https://raitech.co/ Rai Tech | Product & Platform Engineering Company Rai Tech delivers product and platform engineering programmes across distributed systems, cloud architecture, and agentic AI coding enablement. product platform engineeringraitechcompany https://www.robustsoftech.com/ Robust Softech | AI-Powered Platform Engineering for Modern Businesses robust softechai poweredplatform engineeringmodernbusinesses https://engineering.fb.com/2017/03/08/data-center-engineering/introducing-bryce-canyon-our-next-generation-storage-platform/ Introducing Bryce Canyon: Our next-generation storage platform - Engineering at Meta Jun 26, 2018 - Visit the post for more. next generation storagebryce canyonplatform engineeringintroducing https://www.techtarget.com/searchitoperations/news/366569865/Dapr-brings-microservices-principles-to-platform-engineering Dapr brings microservices principles to platform engineering | TechTarget CNCF's Dapr microservices framework and its beta-stage Workflow orchestration tool appeal to IT pros tasked with platform engineering. platform engineeringdaprbringsmicroservicesprinciples https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/Check-ins/20131202 Wikimedia Platform Engineering/MediaWiki Core Team/Check-ins/20131202 - MediaWiki platform engineeringmediawiki corecheck inswikimediateam https://qiita.com/advent-calendar/2023/platform-engineering Platform Engineering - Qiita Advent Calendar 2023 - Qiita Calendar page for Qiita Advent Calendar 2023 regarding Platform Engineering. platform engineeringadvent calendarqiita https://www.infoq.com/news/2026/07/platform-that-helps-developers/ Achieving Compliance as a Platform Engineering Team by Helping Developers - InfoQ Jul 23, 2026 - When a new platform team set out to implement their roadmap through forced workflows with poor documentation, developer experience declined. Success came from... achieving complianceplatform engineering https://miro.com/templates/platform-engineering-purpose-canvas-template/ The Platform Engineering Purpose Canvas the platformengineeringpurposecanvas https://www.computerweekly.com/news/252529565/State-of-DevOps-success-happens-through-platform-engineering State of DevOps: Success happens through platform engineering | Computer Weekly The annual State of DevOps report has focused on a phenomenon known as platform engineering. state ofsuccess happensplatform engineeringdevopscomputer https://www.tidalcommerce.ca/ Digital and Commerce Platform Engineering | Tidal Tidal engineers modern, composable eCommerce platforms and digital solutions that help brands drive growth, agility, and real outcomes. commerce platformdigitalengineeringtidal https://learn.microsoft.com/en-us/platform-engineering/ Platform engineering guide | Microsoft Learn Learn how platform engineering teams can use building blocks from Microsoft and other vendors to create deeply personalized, optimized, and secure developer... platform engineeringguide microsoftlearn https://dev.to/anshul_kichara/basics-of-platform-engineering-internal-developer-platforms-haa Basics Of Platform Engineering & Internal Developer Platforms - DEV Community As reported by Gartner, 58% of IT leaders consider developer experience extremely crucial for their... Tagged with software, technology, trending, devops. internal developer platformsbasicsengineeringcommunity https://blog.budhathokisagar.com.np/ Sagar Budhathoki | DevOps, AWS Cloud & Platform Engineering Blog DevOps, AWS, Terraform, Kubernetes, Docker, CI/CD, and cloud engineering tutorials by Sagar Budhathoki. Practical guides, troubleshooting tips, and real-world... cloud platform engineeringsagardevopsawsblog https://www.hackerstack.org/ Hackerstack | Quality hands-on Platform Engineering stuff Quality hands-on stuff about Platform Engineering. Trustworthy, practical, easy to understand. Linux, Cloud, Containers, Programming, Security, Privacy and more hands onplatform engineeringqualitystuff https://events.linuxfoundation.org/kubecon-cloudnativecon-north-america/co-located-events/platform-engineering-day/ Platform Engineering Day | LF Events Platform Engineering Day is dedicated to exploring the real-world challenges and advanced practices behind building and scaling Internal Developer Platforms… platform engineering daylfevents https://komodor.com/solutions/k8s-integration-internal-development-platform/ Harness Kubernetes for Platform Engineering | Komodor May 22, 2025 - Kubernetes is the backbone of your IDP. Komodor ensures that it’s always running and providing value across the organization. for platform engineeringharnesskuberneteskomodor https://www.techshowlondon.co.uk/dev-ops-live-london DevOps Live London 2027 | The UK's Leading DevOps & Platform Engineering Event In today's digital landscape, continuous delivery and DevOps agility are essential. Gain the skills and solutions to stay ahead at DevOps Live, 10-11 March... devops livethe ukplatform engineeringlondon https://www.mendral.com/ Mendral | Platform Engineering on Autopilot Mendral is the AI DevOps Engineer — three always-on agents for security, reliability, and performance, plus custom automations for any DevOps work specific to... platform engineeringautopilot https://www.computerweekly.com/blog/CW-Developer-Network/Platform-engineering-Xebia-Why-internal-engineering-precedes-external-excellence Platform engineering - Xebia: Why internal engineering precedes external excellence platform engineeringxebiainternalexternalexcellence https://www.shiptalk.io/ ShipTalk - SRE, DevOps, Platform Engineering, Software Delivery ShipTalk is the podcast series on the ins, outs, ups, and downs of software delivery. This series dives into the vast ocean Software Delivery, bringing aboard... devops platformengineering softwareshiptalksredelivery https://www.computerweekly.com/blog/CW-Developer-Network/Platform-Engineering-NetApp-Instaclustr-Open-source-is-the-secret-sauce Platform Engineering - NetApp Instaclustr: Open source is the secret sauce This is a guest post for the Computer Weekly Developer Network written by Anil Inamdar in his capacity as global head of data Services at NetApp Instaclustr -... platform engineeringopen sourcethe secretnetappinstaclustr https://www.infoq.com/minibooks/devex-platform-engineering/ Improving Developer Experience with Platform Engineering - InfoQ Platform engineering has become a hot topic over the last several years. The need to deliver software with speed, safety, and efficiency has driven the rise of... developer experienceplatform engineeringimprovinginfoq https://2022.platformcon.com/ PlatformCon 2022 - The Platform Engineering Conference Welcome to PlatformCon 2022, the first Platform Engineering Conference ever. June 9-10 20222 - Virtual Conference - Talks from DevOps thoughtleaders and... the platformplatformconengineeringconference https://dev.to/mia-platform/pave-golden-paths-with-platform-engineering-33g1 Pave Golden Paths with Platform Engineering - DEV Community Every organization constantly seeks ways to streamline its operations, enhance developer... Tagged with platformengineering, devops, productivity,... platform engineeringpavegoldenpathsdev https://fast.wistia.net/embed/iframe/4a5c1rf8kl Cloud Security in 2025: Empowering Platform Engineering to Secure Innovation cloud securityplatform engineeringempoweringsecureinnovation https://jobs.siemens.com/en_US/externaljobs/ApplicationMethods?folderId=495794 Applying to Manager, Infrastructure Platform Engineering | Careers Marketplace - Siemens Manager, Infrastructure Platform Engineering at created 16-Feb-2026 infrastructure platformengineering careersapplyingmanagermarketplace https://kubernauts.de/en/home/ Kubernauts GmbH | Kubernetes, Platform Engineering, AI & Edge Platforms | Kubernauts Kubernauts delivers Kubernetes, Platform Engineering, AI, Edge Computing and OpenKubes solutions. Build secure cloud-native platforms, AI infrastructure,... platform engineering aigmbhkubernetesedgeplatforms https://jobs.siemens.com/ja_JP/externaljobs/JobDetail/495794 Manager, Infrastructure Platform Engineering - Job Detail | Careers Marketplace - Siemens infrastructure platformengineering jobmanagerdetailcareers https://dev.to/sreekanth_kuruba_91721e5d/devops-vs-platform-engineering-in-2026-h56 DevOps vs Platform Engineering in 2026 - DEV Community DevOps transformed how teams build and ship software. It helped organizations move faster with... Tagged with devops, platformengineering, cloud, kubernetes. platform engineeringdevopsvscommunity https://2023.platformcon.com/ PlatformCon 2023 - The Platform Engineering Conference The top DevOps and platform engineering leaders on one virtual stage, for 2 days. Born to celebrate our community of 15k+ platform engineers 🔥 the platformplatformconengineeringconference https://grafana.com/opentelemetry-report/devops-and-platform-engineering/ OpenTelemetry, DevOps, and platform engineering | Grafana Labs OpenTelemetry adoption, challenges, and solutions research report created by EMA and sponsored by Grafana Labs platform engineeringopentelemetrydevopsgrafanalabs https://www.mediawiki.org/wiki/Wikimedia_Platform_Engineering/MediaWiki_Core_Team/Check-ins/20140303 Wikimedia Platform Engineering/MediaWiki Core Team/Check-ins/20140303 - MediaWiki platform engineeringmediawiki corecheck inswikimediateam https://careers.qualcomm.com/careers/job/446718325339-thermal-engineer-server-platform-engineering-santa-clara-california-united-states-of-america?domain=qualcomm.com Thermal Engineer - Server Platform Engineering | Qualcomm Lead and execute hands-on thermal testing and characterization of server hardware, including heat sinks, cold plates, air cooling and liquid cooling solutions,... thermal engineerplatform engineeringserverqualcomm https://platformengineering.com/ Home - Platform Engineering Jul 2, 2026 - Platform Engineering delivers expert insights on internal developer platforms, automation, tooling, developer experience, and best practices for platform teams. home platformengineering https://clc-conference.eu/ CLC – Die Konferenz zu Developer Experience, Platform Engineering und Software Delivery Die CLC ist eine der führenden deutschen Konferenzen zu Platform Engineering und Developer Experience. Im Fokus stehen Themen wie Software Delivery, DevSecOps,... die konferenzdeveloper experience https://contextual.ai/ Context engineering platform for production-grade AI | Contextual AI Replace DIY complexity with the context engineering platform built for accuracy. Ship production-grade AI that is secure, scalable, and specialized. context engineeringfor productionplatformgradeai https://www.neuralconcept.com/ The leading AI-first engineering platform for product development The engineering AI platform redefining how leading teams design complex products. Trusted by GM, Airbus, VCARB F1 and 70+ global OEMs ai first engineeringfor productleadingplatformdevelopment https://www.crossplane.io/ Crossplane Is the Cloud-Native Framework for Platform Engineering Create platforms like cloud providers by building your own APIs and services with control planes, extending Kubernetes to manage any resource anywhere, and... the cloudcrossplanenativeframeworkplatform https://github.com/langfuse/langfuse GitHub - langfuse/langfuse: 🪢 Open source AI engineering platform: LLM evals, observability,... 🪢 Open source AI engineering platform: LLM evals, observability, metrics, prompt management, playground, datasets. Integrates with OpenTelemetry, LangChain,... open source aillm evalsgithublangfuse