https://www.verisign.com/
A global provider of domain name registry services and internet infrastructure | Verisign
Verisign, a global provider of domain name registry services and internet infrastructure, enables internet navigation for many of the world’s most recognized...
domain nameregistry servicesinternet infrastructureglobalprovider
https://circleid.com/topics/registry_services
Registry Services - CircleID
registry services
https://www.tucowsregistry.com/nixi-whitepaper
Tucows Registry Services | NIXI (.IN) Domain Migration Case Study
See how Tucows Registry Services became the technical services provider for India’s NIXI migrating 4.2M+ domains and 125 extensions, while ensuring DNS...
registry servicesdomain migrationcase studytucowsnixi
https://github.blog/engineering/engineering-principles/bringing-npm-registry-services-to-github-codespaces/
Bringing npm registry services to GitHub Codespaces - The GitHub Blog
The npm engineering team recently transitioned to using GitHub Codespaces for local development for npm registry services. This shift to Codespaces has...
registry servicesgithub codespacesthe blogbringingnpm
https://shortdot.bond/domain-registry-services
Registry Services - ShortDot
ShortDot offers highly-sophisticated and innovative registry services covering a wide range of functions and capabilities.
registry services
https://www.tucowsregistry.com/contact
Tucows Registry Services | Contact Us
Get in touch with Tucows Registry Services for trusted, ICANN-compliant services for gTLDs, ccTLDs, and DotBrands.
registry servicescontact ustucows
https://support.registry.se/sv
Support Portal | Registry Services
support portalregistry services
https://www.ucl.ac.uk/srs/user/login?destination=node/9168
User account | Student and Registry Services - UCL – University College London
UCL is consistently ranked as one of the top ten universities in the world (QS World University Rankings 2010-2022) and is No.2 in the UK for research power...
university college londonuser accountregistry servicesstudentucl
https://www.tucowsregistry.com/platform
Tucows Registry Services | All-In-One Domain Registry Platform
Tucows Registry Services helps TLD registries scale with automated onboarding, resilient infrastructure, and customizable solutions.
all in oneregistry servicestucowsdomainplatform
https://www.verisign.com/?afscampaignid=1
A global provider of domain name registry services and internet infrastructure | Verisign
Verisign, a global provider of domain name registry services and internet infrastructure, enables internet navigation for many of the world’s most recognized...
domain nameregistry servicesinternet infrastructureglobalprovider
https://www.qld.gov.au/family/help-centre
Help centre for Brisbane registry services | Family, relationships, births and deaths | Queensland...
Find answers to frequently asked questions about our services.
births and deathshelp centreregistry servicesfamily relationshipsbrisbane
https://ris.kfintech.com/
Corporate Registry Services | Business Registry |Companies Registry | KFintech
registry servicescorporatebusinesscompanies
https://www.tucowsregistry.com/privacy-policy
Tucows Registry Services | Privacy Policy
Grow your TLD on an industry-leading platform. Trusted by registries worldwide for resilience, global reach, and expert guidance.
services privacy policytucowsregistry
https://www.tucowsregistry.com/gtld-next-round
ICANN Registry Services Provider for New gTLD Applicants | Tucows Registry
ICANN-evaluated Registry Service Provider for the 2026 gTLD round. Dedicated registry infrastructure, compliant launches, and proven migrations at scale.
registry servicesnew gtldicannproviderapplicants
https://registry.godaddy/
Domain Name Registry Services - GoDaddy Registry
Sep 11, 2025 - We launch, secure and grow TLDs for countries, brands and registries. To request more information Contact us Whether you’re looking for an innovative registry...
domain nameregistry servicesgodaddy
https://nominet.uk/registry-services/
Registry Services - Nominet
Apr 13, 2026 - We’re custodians of the UK's domain name registry, looking after over 10 million domains and supporting some of the world's leading brands.
registry servicesnominet
https://nominet.uk/news/nominet-confirmed-as-registry-services-provider-for-icanns-new-gtld-program/
Nominet confirmed as Registry Services Provider for ICANN’s New gTLD program - Nominet
Feb 2, 2026 - Nominet, has been confirmed as a pre-evaluated Registry Services Providers (RSPs) by ICANN for its New gTLD program.
new gtld programregistry servicesnominetconfirmedprovider
https://registryservices.ed.ac.uk/
Registry Services | Student Administration
STUDENT ADMINISTRATION
registry servicesstudent administration
https://jprs.co.jp/en/jpdomain.html
Guide to JP Domain Name / Japan Registry Services Co., Ltd.
Japan Registry Services Co., Ltd. carries out registration and administration of the JP domain name.
domain nameregistry servicesguidejpjapan
https://www.tucowsregistry.com/
Tucows Registry Services | For gTLDs, ccTLDs & DotBrands
Grow your TLD on an industry-leading platform. Trusted by registries worldwide for resilience, global reach, and expert guidance.
registry servicestucowsgtldscctldsdotbrands
https://support.registry.se/en-US
Support Portal | Registry Services
support portalregistry services
https://www.verisign.com/about-us/leadership/pat-kane/
Pat Kane | Senior Vice President, Naming and Registry Services | Verisign
Pat Kane is Senior Vice President of Naming and Registry Services at Verisign.
vice presidentregistry servicespatkanesenior
https://www.tucowsregistry.com/about
Tucows Registry Services | About Us
Tucows Registry Services is an ICANN-accredited provider delivering modern, scalable technology and expert guidance for gTLD, ccTLD, and dotBrand operators....
registry servicestucowsus
https://brsmedia.com/
BRS Media | Registry Services for Top-Level Domains - BRS Media
Jan 26, 2026 - In 1998, BRS Media launched a little known country domain extension and turned it into one of the best recognized and most successful rebranded Top-Level...
top level domainsregistry servicesbrsmedia
https://centralnicregistry.com/services/
Services - CentralNic Registry
centralnic registryservices
https://www.cr.gov.hk/en/electronic/e-servicesportal/faq/e-search.htm
Companies Registry - FAQs on e-Services - Electronic Search
companiesregistryfaqsserviceselectronic