Robuta

https://www.verisign.com/ A global provider of domain name registry services and internet infrastructure | Verisign Verisign, a global provider of domain name registry services and internet infrastructure, enables internet navigation for many of the world’s most recognized... domain nameregistry servicesinternet infrastructureglobalprovider https://circleid.com/topics/registry_services Registry Services - CircleID registry services https://www.tucowsregistry.com/nixi-whitepaper Tucows Registry Services | NIXI (.IN) Domain Migration Case Study See how Tucows Registry Services became the technical services provider for India’s NIXI migrating 4.2M+ domains and 125 extensions, while ensuring DNS... registry servicesdomain migrationcase studytucowsnixi https://github.blog/engineering/engineering-principles/bringing-npm-registry-services-to-github-codespaces/ Bringing npm registry services to GitHub Codespaces - The GitHub Blog The npm engineering team recently transitioned to using GitHub Codespaces for local development for npm registry services. This shift to Codespaces has... registry servicesgithub codespacesthe blogbringingnpm https://shortdot.bond/domain-registry-services Registry Services - ShortDot ShortDot offers highly-sophisticated and innovative registry services covering a wide range of functions and capabilities. registry services https://www.tucowsregistry.com/contact Tucows Registry Services | Contact Us Get in touch with Tucows Registry Services for trusted, ICANN-compliant services for gTLDs, ccTLDs, and DotBrands. registry servicescontact ustucows https://support.registry.se/sv Support Portal | Registry Services support portalregistry services https://www.ucl.ac.uk/srs/user/login?destination=node/9168 User account | Student and Registry Services - UCL – University College London UCL is consistently ranked as one of the top ten universities in the world (QS World University Rankings 2010-2022) and is No.2 in the UK for research power... university college londonuser accountregistry servicesstudentucl https://www.tucowsregistry.com/platform Tucows Registry Services | All-In-One Domain Registry Platform Tucows Registry Services helps TLD registries scale with automated onboarding, resilient infrastructure, and customizable solutions. all in oneregistry servicestucowsdomainplatform https://www.verisign.com/?afscampaignid=1 A global provider of domain name registry services and internet infrastructure | Verisign Verisign, a global provider of domain name registry services and internet infrastructure, enables internet navigation for many of the world’s most recognized... domain nameregistry servicesinternet infrastructureglobalprovider https://www.qld.gov.au/family/help-centre Help centre for Brisbane registry services | Family, relationships, births and deaths | Queensland... Find answers to frequently asked questions about our services. births and deathshelp centreregistry servicesfamily relationshipsbrisbane https://ris.kfintech.com/ Corporate Registry Services | Business Registry |Companies Registry | KFintech registry servicescorporatebusinesscompanies https://www.tucowsregistry.com/privacy-policy Tucows Registry Services | Privacy Policy Grow your TLD on an industry-leading platform. Trusted by registries worldwide for resilience, global reach, and expert guidance. services privacy policytucowsregistry https://www.tucowsregistry.com/gtld-next-round ICANN Registry Services Provider for New gTLD Applicants | Tucows Registry ICANN-evaluated Registry Service Provider for the 2026 gTLD round. Dedicated registry infrastructure, compliant launches, and proven migrations at scale. registry servicesnew gtldicannproviderapplicants https://registry.godaddy/ Domain Name Registry Services - GoDaddy Registry Sep 11, 2025 - We launch, secure and grow TLDs for countries, brands and registries. To request more information Contact us Whether you’re looking for an innovative registry... domain nameregistry servicesgodaddy https://nominet.uk/registry-services/ Registry Services - Nominet Apr 13, 2026 - We’re custodians of the UK's domain name registry, looking after over 10 million domains and supporting some of the world's leading brands. registry servicesnominet https://nominet.uk/news/nominet-confirmed-as-registry-services-provider-for-icanns-new-gtld-program/ Nominet confirmed as Registry Services Provider for ICANN’s New gTLD program - Nominet Feb 2, 2026 - Nominet, has been confirmed as a pre-evaluated Registry Services Providers (RSPs) by ICANN for its New gTLD program. new gtld programregistry servicesnominetconfirmedprovider https://registryservices.ed.ac.uk/ Registry Services | Student Administration STUDENT ADMINISTRATION registry servicesstudent administration https://jprs.co.jp/en/jpdomain.html Guide to JP Domain Name / Japan Registry Services Co., Ltd. Japan Registry Services Co., Ltd. carries out registration and administration of the JP domain name. domain nameregistry servicesguidejpjapan https://www.tucowsregistry.com/ Tucows Registry Services | For gTLDs, ccTLDs & DotBrands Grow your TLD on an industry-leading platform. Trusted by registries worldwide for resilience, global reach, and expert guidance. registry servicestucowsgtldscctldsdotbrands https://support.registry.se/en-US Support Portal | Registry Services support portalregistry services https://www.verisign.com/about-us/leadership/pat-kane/ Pat Kane | Senior Vice President, Naming and Registry Services | Verisign Pat Kane is Senior Vice President of Naming and Registry Services at Verisign. vice presidentregistry servicespatkanesenior https://www.tucowsregistry.com/about Tucows Registry Services | About Us Tucows Registry Services is an ICANN-accredited provider delivering modern, scalable technology and expert guidance for gTLD, ccTLD, and dotBrand operators.... registry servicestucowsus https://brsmedia.com/ BRS Media | Registry Services for Top-Level Domains - BRS Media Jan 26, 2026 - In 1998, BRS Media launched a little known country domain extension and turned it into one of the best recognized and most successful rebranded Top-Level... top level domainsregistry servicesbrsmedia https://centralnicregistry.com/services/ Services - CentralNic Registry centralnic registryservices https://www.cr.gov.hk/en/electronic/e-servicesportal/faq/e-search.htm Companies Registry - FAQs on e-Services - Electronic Search companiesregistryfaqsserviceselectronic