Robuta

https://www.framer.com/marketplace/templates/recruitify/
Recruitify is a versatile Framer template tailored for recruitment agencies, featuring 10+ ready-to-use pages with responsive layouts, modern animations, and...
business websiteresponsivetemplatemuhammadtalha
https://colorlib.com/wp/template/mosh/
May 25, 2022 - If you run a business that helps others design stuff, Mosh free responsive creative agency website template is to consider. Professional, modern and advanced,...
creative agencywebsite templatemoshbestresponsive
https://www.mailerlite.com/templates/websites/health
A health coach website template is ideal for nutrition, wellness and self-care coaches. Use our no-code drag and drop builder to customize it to your brand.
health coachwebsite templateresponsive
https://preview.tabler.io/
Tabler is packed with beautifully crafted components and powerful features. Jump in and start building a stunning dashboard — all for free!
open sourcedashboardtablerpremiumtemplate
https://ltheme.com/project/lt-puppy-responsive-pet-shop-joomla-template/
 Are you looking for the best option for a pet shop? If yes, don't hesitate to check out LT Puppy Joomla Template which is an incredibly customizable and
pet shopltpuppyresponsivejoomla
https://themewagon.com/themes/kelly/
Kelly is a free Bootstrap 5 portfolio template with better SEO. It enhances user engagement with responsiveness and page-speed optimization.
portfolio websitekellyfreeresponsivebootstrap
https://themewagon.com/themes/spin/
Spin is a contemporary high-performing landing page template with meticulously designed layouts. It comes with thoughtfully made UI components for you!
spinresponsivebootstraplandingtemplate
https://tabler.io/admin-template
Tabler is a free HTML admin template packed with well-designed components and features. Start your adventure with Tabler and make your dashboard great again!
admin templatetablerresponsivehtmldashboard
https://gooyaabitemplates.com/moksha-responsive-blogger-template/
Dec 14, 2020 - Moksha Responsive Blogger Template blogger templates free blogger templates. Blogger free templates, 2014 blogger templates seo blogger themes free 2014
free templatesmoksharesponsiveblogger
https://gooyaabitemplates.com/hotmag-responsive-blogger-template/
Dec 14, 2020 - Hot mag Responsive Blogger Template. Free Professional Blogger Template Responsive SEO Ready Fashion Photography Portfolio Designs.
hotmagresponsivebloggertemplate
https://www.framer.com/marketplace/templates/nakula/
A bold and professional Framer template for portfolios and agencies, designed for creativepreneurs who want to build and launch their website fast.
portfolio websiteresponsivetemplatethemesframer
https://www.framer.com/marketplace/templates/templify/
Templify is an innovative Framer Digital Store Theme designed to empower you in creating and selling website templates effortlessly.
ecommerce website templateresponsivemuhammadtalhaframer
https://ltheme.com/project/lt-carenix-responsive-health-care-joomla-template/
The LT Carenix Joomla template is an excellent choice for those in the healthcare industry looking to create a professional and visually appealing website.
health careresponsivejoomlatemplate
https://www.cssfounder.com/email-template-design/
Create engaging email campaigns with our responsive email template design services. Mobile-optimized, HTML email templates for maximum open & click-through...
email templatedesign servicescss founderresponsive
https://themewagon.com/themes/medicare/
Medicare is a premium in-house medical website template. It's a Bootstrap theme, providing responsiveness & cross-browser compatibility across all...
fully responsivewebsite templatemedicarebootstrapmedical
https://themewagon.com/themes/free-responsive-bootstrap-5-multipurpose-website-template-boldo/
Boldo is a responsive landing page tempalte that's built using Bootstrap 5, HTML5 ensuring compatibility around all devices & Browsers.
freeresponsivebootstrapmultipurposelanding
https://www.framer.com/marketplace/templates/convertify/
Convertify is a premium Framer template crafted for sales consulting agencies that aim to boost client engagement and elevate their digital footprint....
business websiteresponsivetemplatemuhammadtalha
https://themewagon.com/themes/salone/
Download Salone, a free, Bootstrap 5 business website template with a clean codebase. It offers easy customization, full responsiveness, and better SEO.
freeresponsivebootstrapbusinesstemplate
https://www.framer.com/marketplace/templates/collective/
Collective is a beautiful, modern, and fast website inspiration directory Framer template. Built with SEO in mind: dynamic category pages, powerful filters,...
business websitecollectiveresponsivetemplatebryn
https://colorlib.com/wp/template/massive/
Jun 25, 2021 - Are you about to release a fresh new mobile app but you do not have a website yet? Choose Massive free responsive app landing website template and execute...
website templatemassivefreeresponsiveapp
https://www.craftedtemplate.com/templates/free-responsive-wristwatch-landing-page-template
Free responsive wristwatch landing page template built with Vite, React, Tailwind CSS v4, and Framer Motion. Includes hero, navbar, product grids, features,...
freeresponsivewristwatchlandingtemplate
https://www.framer.com/marketplace/templates/framerhub/
Unlock the full potential of your online presence with FrameHub, the premier Framer website Template service.
ecommerce website templateresponsivemuhammadtalhaframer
https://visualmodo.com/theme/architect-wordpress-theme/
Jan 9, 2025 - Architect, Best WordPress theme & template for interior studio, construction, residential, furniture, interior design, building & more sites
wordpress themeinterior designresponsive templatearchitect
https://themewagon.com/themes/lounge/
Download Lounge, a free & modern restaurant website template with clean codebase. The HTML theme offers faster loading times, responsiveness, and better SEO
restaurant websiteloungefreeresponsivehtml
https://www.framer.com/marketplace/templates/wiltord/
WILTORD is a futuristic landing page template for AI Agencies (Designers & Studios) that want to showcase the power of their ideas and sell. Cinematic...
agency websiteresponsivetemplatesabosugi
https://themewagon.com/themes/perfectcut/
Download PerfectCut, a free & responsive Bootstrap theme with easy customization. Give your Salon website a clean & professional look with faster...
salon websitefreeresponsivebootstraptemplate
https://colorlib.com/wp/template/webhost/
Feb 8, 2023 - Webhost is your best free responsive web hosting website template if you are building a web hosting company and domain registrar.
responsive webhosting websitewebhostfreetemplate
https://themewagon.com/themes/roadtrip/
RoadTrip is a free HTML5 landing page template with sleek design. It offers easy customization, responsiveness, and better SEO with optimized page speed.
roadtripfreeresponsivelandingtemplate
https://themewagon.com/themes/raven/
Raven Pro is a Bootstrap 4 responsive law agency website template. Any legal and legislature farm can showcase their services seamlessly through Raven Pro.
agency websiteravenresponsivebootstraplegal
https://colorlib.com/wp/template/fastes/
Feb 8, 2023 - Fastes is your number one free responsive hosting website template solution to start on the internet as fast as possible with a striking business page.
hosting websitefreeresponsivetemplatecolorlib
https://ltheme.com/project/lt-driving-responsive-driving-school-joomla-template/
The LT Driving Joomla Template offers a 100% responsive layout that is based on the robust Helix Ultimate Framework and SP Page Builder, ensuring a seamless
ltdrivingresponsiveschooljoomla
https://www.framer.com/marketplace/templates/kanva/
A sleek and modern Framer e-commerce template with seamless Shopify integration. Built for flexibility and full responsiveness, it's ideal for launching a...
ecommerce website templateresponsivepawelgolaframer
https://cruip.com/solid/
Nov 12, 2023 - Solid is a responsive dark landing page template with a futuristic edge ideal for showing off digital products, SaaS apps, and tech tools.
responsivedarklandingtemplatesolid
https://themewagon.com/themes/nextly/
Build beautiful landing pages with Nextly, clean & responsive. It’s a Tailwind CSS template, providing faster loading times & help get higher ranking.
tailwind cssfreeresponsivelandingtemplate
https://ltheme.com/project/responsive-food-recipe-joomla-template-gt-recipe/
Experience amazing design possibilities with GT Recipe template - the perfect choice for anyone looking to build a modern, stylish recipe or food news
food reciperesponsivejoomlatemplategt
https://ltheme.com/project/responsive-construction-joomla-template-gt-construction/
GT Construction Joomla Template is one of the finest websites for construction services. Developed by the renowned Helix Ultimate Framework and SP Page
responsiveconstructionjoomlatemplategt
https://colorlib.com/wp/template/roberto/
Jul 19, 2024 - Roberto is a professional HTML website template for any accommodation business that needs an extra boost online.
hotel websiterobertoresponsivehtmltemplate
https://theme.bitrixinfotech.com/product-detail/traders-website-template-in-bootstrap-for-investment-and-forex
Clean and modern HTML template for forex brokers, traders, and investment businesses. Easily manage your portfolio with our ready-to-use templates.
forex tradinginvestment websitehtml responsiveamptemplate
https://colorlib.com/wp/template/chimper/
Jun 25, 2021 - Chimper is a free responsive web agency website template with a modern and contemporary design that effortlessly adapts to your business venture.
responsive webagency websitefreetemplatecolorlib
https://themewagon.com/themes/retrospect/
Get Retrospect, the exclusive free landing page template, providing complete responsiveness. It’s also optimized for page speed and search engine results.
freeresponsivelandingtemplatethemewagon
https://www.mailerlite.com/templates/websites/illustrator
Customize our illustration portfolio website template to match your brand. Start a blog with a click, connect analytics and more. Learn more.
illustration portfoliowebsite templateresponsive
https://www.framer.com/marketplace/templates/zayla/
A striking and modern Framer template made for independent creatives, developers, artists, and visionaries who want to leave a powerful first impression.
personal websitezaylaresponsivetemplatezaid
https://gooyaabitemplates.com/journal-responsive-blogger-template/
Dec 14, 2020 - Journal Responsive Blogger Template. Free Professional Blogger Template Responsive SEO Ready Fashion Photography Portfolio Designs.
journalresponsivebloggertemplateblogspot
https://www.framer.com/marketplace/templates/marketify/
Elevate your web design game with Marketify Framer Template. This sleek and modern template is designed to help you create stunning and highly functional...
business websiteresponsivetemplatemuhammadtalha
https://www.framer.com/marketplace/templates/optimo/
Optimo is a modern Framer consultation template for business consulting firms. Best suitable for investment consultations, professional training, marketing...
coaching websiteresponsivetemplateframermarketplace
https://colorlib.com/wp/template/launch/
Oct 2, 2025 - Launch is an impactful and responsive app landing website template that will help promote your project professionally.
website templatelaunchbestresponsiveapp
https://www.framer.com/marketplace/templates/brog/
BROG® is a modern, minimal Framer template crafted for design-driven studios. Featuring a bold monochrome aesthetic and clean grid structure, it delivers an...
photography website templateresponsiveframer
https://ltheme.com/project/free-responsive-coffee-joomla-template-gt-coffee/
GT Coffee Joomla Template is a powerful and feature-packed template, expressly designed for coffee shop. It was developed with the help of the popular and
freeresponsivecoffeejoomlatemplate
https://ltheme.com/project/responsive-wine-shop-joomla-template-gt-wine/
GT Wine Joomla Template is a top-notch solution for winery businesses looking to establish an online presence. Utilizing the powerful Helix Ultimate Framework
wine shopresponsivejoomlatemplategt
https://www.framer.com/marketplace/templates/brandigo/
Brandigo is a bold marketing agency template built in Framer, designed to help creative agencies, studios, and consultants showcase their services with style...
blog websiteresponsivetemplatemuhammadtalha
https://themewagon.com/themes/broadcast/
Enjoy Broadcast, a free HTML5 entertainment website template. The theme offers complete responsiveness and optimized page speed with a clean codebase.
website templatebroadcastfreeresponsiveentertainment
https://ltheme.com/project/responsive-online-tea-shop-jooma-template-gt-tea/
The GT Tea Joomla Template is a highly advanced and versatile platform that allows you to create a stunning online tea store website. It is designed to cater
tea shopresponsiveonlinetemplategt
https://www.touchpoint.com/?utm_source=submitaitools.org&utm_medium=referral
Chat with AI to create professional designs and generate clean HTML email templates. No coding or design skills are required. Start for free today.
email template buildergenerateresponsivedesignstouchpoint
https://themewagon.com/themes/iportfolio/
iPortfolio is a free Bootstrap 5 portfolio website template. It has a one-page design, cross-browser compatibility, responsiveness, and higher SEO.
portfolio websitefreeresponsivebootstraptemplate
https://colorlib.com/wp/template/ithost/
Feb 8, 2023 - ITHost is a responsive web hosting website template with a modern and easy to use web design that will push your hosting services to a new degree.
responsive webhosting websitetemplatecolorlib
https://ltheme.com/project/responsive-pharmacy-joomla-template-gt-pharhub/
Do you seek for a top-notch pharmacy template for your Joomla website? Don't hesitate to check out GT Pharhub. This template is not only compatible with SP
responsivepharmacyjoomlatemplategt
https://www.framer.com/marketplace/templates/plyn/
Plyń is an ultra-minimal portfolio template built for creatives who believe less truly is more. No clutter. No distractions. Your work is the statement. Plyń...
personal websiteresponsivetemplatedesignframer
https://www.mailerlite.com/templates/websites/event
Check out this event website template. Build an event website and start selling tickets in short time. Get started.
event websiteresponsivetemplate
https://oldsite.alessioatzeni.com/blog/anubis-responsive-retina-ready-html-template/
Mar 9, 2014 - Anubis is the pixel-perfect responsive HTML template based on Twitter Bootstrap Framework, it is optimized for Retina Displays.
html templateanubisresponsiveretinaready
https://themewagon.com/themes/free-html5-bootstrap-4-responsive-travel-agency-website-template-trip-spot/
Trip Spot is a free HTML5 Bootstrap 4 responsive travel agency website template. Super cool features like hero header, full-screen slider, search box with...
travel agencytripspotfreebootstrap
https://themewagon.com/themes/freshcart/
Build an amazing eCommerce template with FreshCart. It’s a free Tailwind CSS website template built, offering faster loading times & full responsiveness.
tailwind cssecommerce templatefreeresponsivethemewagon
https://nicepage.com/jt/3424920/uiux-responsive-development-joomla-template
UI/UX Responsive Development. Professional Joomla Template. Responsive, fully customizable with easy Drag-n-Drop editor. You can use it for subjects like...
ui uxresponsivedevelopmentjoomlatemplate
https://colorlib.com/wp/template/expert/
Oct 14, 2022 - Expert is the best free responsive single page website template that works for agencies, freelancers, even product showcases.
website templateexpertfreeresponsivesingle
https://store.shopware.com/de/cbax971155613280m/theme-mars-flat-responsive-template.html
Mit 23 kostenlos enthaltene Funktionen und Plugins + neue Erweiterung für die Einkaufswelten, welche Sie nicht verpassen sollten Es ist ein modernes Full...
responsive templatethememarsflat
https://themewagon.com/themes/free-responsive-bootstrap-5-html5-travel-website-template-voyage/
Voyage is our in-house produced free Bootstrap 5 template for travel websites. It provides faster loading times with reduced bounce rates & responsiveness.
travel websitevoyagefreeresponsivebootstrap
https://themewagon.com/themes/grid/
Grid is a free Bootstrap 4 multipurpose website template. It comes with modern and responsive UI components that you can use for better user experience.
website templategridresponsivebootstrapmultipurpose
https://www.framer.com/marketplace/templates/advisora/
Advisora is a professional Finance & SaaS template. Designed to empower individuals and businesses, it combines financial services and software tools in a...
startup websiteresponsivetemplatetemlisframer
https://gooyaabitemplates.com/xmax-portfolio-responsive-blogger-template/
Oct 17, 2019 - Xmax portfolio Responsive Blogger Template blogger templates free blogger templates. Blogger free templates, 2014 blogger templates. blog templates 2014
free templatesxmaxportfolioresponsiveblogger
https://www.framer.com/marketplace/templates/orbai/
Orbai is a premium Framer template built to elevate your AI automation agency. Designed with a sleek, modern aesthetic, Orbai gives you the perfect platform to...
agency websiteresponsivetemplateframermarketplace
https://templatesell.com/
Discover Website Templates, WordPress Themes and Plugin from all around the world.
wordpress themesbestpremiumfreeresponsive
https://colorlib.com/wp/template/world/
Jul 22, 2024 - World is a stunning and responsive magazine website template. It has everything you need to start writing compelling articles and create a place where everyone...
magazine websiteworldbestresponsivetemplate
https://themewagon.com/themes/binary/
Enjoy Binary, a responsive HTML5 landing page template. The free theme has a clean codebase that offers easy customization, faster loading, and better SEO.
binaryfreeresponsiveamplanding
https://ltheme.com/project/lt-brewery-free-responsive-beer-shop-joomla-template/
LT Brewery is a professional Joomla template created for beer shops. Built with both SP Page Builder and the Helix Ultimate Framework, this template gives you
beer shopltbreweryfreeresponsive
https://osclasspoint.com/osclass-themes/classifieds-marketplace/epsilon-osclass-theme-i194
Discover the Epsilon Osclass theme, a premium, fully responsive template designed for classifieds and marketplace websites. With modern design, fast loading,...
epsilonpremiumthemeresponsiveclassifieds
https://www.framer.com/marketplace/templates/floraly/
Showcase your floral artistry and photography with this stunning Framer template, designed for florists, flower designers, and wedding photographers.
business websiteresponsivetemplateiremframer
https://colorlib.com/wp/template/avision/
Jul 22, 2024 - Avision is a responsive magazine website template with goodies upon goodies for your convenience. You can craft online fashion, business, sport, travel, car,...
magazine websiteavisionresponsivetemplatecolorlib
https://colorlib.com/wp/template/gourmet/
Aug 8, 2023 - Gourmet is the best free responsive restaurant website template for all food businesses which are looking to boost their potential through the roof.
restaurant websitegourmetfreeresponsivetemplate
https://ltheme.com/project/responsive-army-news-joomla-template-gt-military/
Are you ready to make your mark in the world of military news? Then turn your attention to GT Military - the ultimate Joomla 4 template. First of all, this
responsivearmynewsjoomlatemplate