Robuta

https://www.algolia.com/ The AI search and retrieval platform - Agentic | Generative | Search ai searchretrievalplatformagenticgenerative https://www.epa.gov/waterdata/storage-and-retrieval-and-water-quality-exchange-domain-services-and-downloads STOrage and RETrieval and Water Quality eXchange Domain Services and Downloads | US EPA Oct 31, 2025 - This page contains information and a collection of links relating to STORET and WQX Domains. water qualitydomain servicesdownloads usstorageretrieval https://www.meilisearch.com/ Meilisearch: Unified Search & AI Retrieval Platform Meilisearch: Unifying your search and AI stack in a single information retrieval platform. unified searchmeilisearchairetrievalplatform https://www.jlis.it/index.php/jlis/article/view/735 Evaluating Retrieval-Augmented Generation for personal collections: architecture, models and... for personalevaluatingretrievalaugmentedgeneration https://simplesolutions.org/educational-workbooks/summer-school-online/summer-solutions/ Summer Solutions - Elementary School Workbooks, Interleaving and Retrieval Practice - Simple... Dec 23, 2025 - Summer Solutions prevents learning loss across math, reading, English, Spanish, study skills, and problem solving. Help students keep their skills sharp all... summer solutionselementary schoolretrieval practiceworkbooksinterleaving https://omcrs.nia.gov.ph/ Memorandum Circulars | NIA - Online Memorandum Circular Retrieval System memorandum circularsniaonlineretrievalsystem https://chartswap.com/ ChartSwap: Secure Medical Records Retrieval Software medical records retrievalsecuresoftware https://trec.nist.gov/ Text REtrieval Conference textretrievalconference https://www.anthropic.com/engineering/contextual-retrieval Contextual Retrieval in AI Systems \ Anthropic Explore how Anthropic enhances AI systems through advanced contextual retrieval methods. Learn about our approach to improving information access and relevance... ai systemscontextualretrievalanthropic https://eureka.patsnap.com/topic-patents-groundwater Groundwater patented technology retrieval search results - Eureka | Patsnap This page includes the patent name, patent number, legal status, invention/applicant, technical efficacy and accompanying drawings of Groundwater-related... patented technologysearch resultsgroundwaterretrievaleureka https://www.elastic.co/search-labs/blog/introducing-elser-v2-part-2 ELSER: Optimizing retrieval with ELSER v2 - Elasticsearch Labs Oct 9, 2024 - Learn how we are reducing the retrieval costs of the Learned Sparse EncodeR (ELSER) v2. optimizingretrievalelasticsearchlabs https://zilliz.com/ai-faq/what-are-the-open-problems-for-image-retrieval What are the open problems for image retrieval? - Zilliz Vector Database Image retrieval is an essential area of computer vision, but it faces several open problems that affect its effectivenes what arethe openfor imagevector databaseproblems https://bytez.com/docs/arxiv/1811.01574/paper Low-Rank Phase Retrieval via Variational Bayesian Learning | Read Paper on Bytez Nov 5, 2018 - In this paper, we consider the problem of low-rank phase retrieval whose objective is to estimate a complex low-rank matrix from magnitude-only measurements.... read paperlowrankphaseretrieval https://research.buaa.edu.cn/en/publications/pre-training-cross-modal-retrieval-by-expansive-lexicon-patch-ali/ Pre-training Cross-Modal Retrieval by Expansive Lexicon-Patch Alignment - Beihang University pre trainingbeihang universitycrossmodalretrieval https://smacc.com/en/smacc-data-retrieval/ How to do a data retrieval? | SMACC Visit SMACC to learn the steps on how to retrieve the data efficiently and the cases when these steps should be used. how to doa dataretrieval https://researchoutput.ncku.edu.tw/en/publications/phase-retrieval-with-one-or-two-diffraction-patterns-by-alternati/ Phase Retrieval with One or Two Diffraction Patterns by Alternating Projections with the Null... phaseretrievalonetwodiffraction https://www.scipedia.com/search?q=Information+retrieval+systems&search_type=tags Results for "Information retrieval systems" : Scipedia for informationretrieval systemsresults https://researcher.manipal.edu/en/publications/a-novel-private-information-retrieval-technique-for-private-dns-r/ A novel private information retrieval technique for private DNS resolution - Manipal Academy of... a novelprivate informationdns resolutionretrievaltechnique https://1docretrieval.com/document-retrieval/alabama/homewood/environmental-records Document Retrieval Services | Court Records | 1Doc document retrievalcourt recordsservices https://www2.gov.bc.ca/gov/content/industry/crown-land-water/crown-land/gator Government Access Tool for Online Retrieval (GATOR) - Province of British Columbia GATOR provides a way to search the B.C. Crown land registry for information on grants, surveys, and wellsites. access toolfor onlinebritish columbiagovernmentretrieval https://www.ijcai.org/proceedings/2018/92 Dual Adversarial Networks for Zero-shot Cross-media Retrieval | IJCAI Electronic proceedings of IJCAI 2018 zero shotcross mediadualadversarialnetworks https://research.tue.nl/en/publications/radiometric-retrieval-of-tropospheric-parameters/ Radiometric retrieval of tropospheric parameters - Research portal Eindhoven University of... research portalradiometricretrievaltroposphericparameters https://research.tudelft.nl/en/publications/shrec-2019-monocular-image-based-3d-model-retrieval-2/ SHREC 2019 - Monocular image based 3D model retrieval - TU Delft Research Portal tu delftresearch portalmonocularimagebased https://community-forums.domo.com/main/discussion/62212/workbench-jobs-retrieval Workbench jobs retrieval - Domo Community Forum Hi I'm trying to retrieve all the codes that I've created for my dataset jobs. This was removed when I changed password. However, as I checked the datasets in... community forumworkbenchjobsretrievaldomo https://article.org.in/automated-storage-and-retrieval-system-market-warehouse-growth/ Automated Storage and Retrieval System Market Warehouse Growth | Article Inside Driving Next-Generation Automotive Solutions with Automated Storage And Retrieval System Market The growing significance of the Automated Storage And Retrieval... automated storageretrievalsystemmarketwarehouse https://aclanthology.org/2022.findings-emnlp.437/ Named Entity and Relation Extraction with Multi-Modal Retrieval - ACL Anthology Xinyu Wang, Jiong Cai, Yong Jiang, Pengjun Xie, Kewei Tu, Wei Lu. Findings of the Association for Computational Linguistics: EMNLP 2022. 2022. relation extractionnamedentitymultimodal https://handbook.monash.edu/2023/units/par5240 PAR5240 - Aeromedical retrieval rescue for intensive care paramedics - Monash University This is the official site of the Monash University Handbook for course and unit information. intensive caremonash universityaeromedicalretrievalrescue https://research.jku.at/en/activities/knowledgepearls-provenance-based-visualization-retrieval/ KnowledgePearls: Provenance-Based Visualization Retrieval - JKU & KUK Research Portal research portalprovenancebasedvisualizationretrieval https://researchexperts.utmb.edu/en/publications/intravascular-ultrasound-guided-thrombus-retrieval-with-a-multipu/ Intravascular ultrasound-guided thrombus retrieval with a multipurpose-angled catheter during... with aultrasoundguidedthrombusretrieval https://www.infovis.org/archives/list/infovis@infovis.org/thread/TKBC63IYYU6TUTOZT4LXOGVAHUF7AZMS/ Final CfP: International Workshop on Knowledge Maps and Information Retrieval (KMIR) at DL 2014 -... maps and informationinternational workshopfinalcfpknowledge https://scghed.com/2014/05/cme-15514-retrieval-medicine-western-australia/ CME 15/5/14 - Retrieval Medicine in Western Australia - Charlie's ED Aug 21, 2018 - Retrieval Medicine in Western Australia retrieval medicinewestern australiacmecharlie https://www.preprints.org/manuscript/202505.1358 ContrastGen: A Multi-Agent Contrastive Framework for Hard Retrieval Data Generation and Mining[v2]... The embedding model vectorizes queries and passages separately and uses the distance between the two resulting vectors as the basis for retrieval matching. It... multi agentdata generationframeworkhardretrieval https://www.njsba.org/news-publications/njsbas-request-for-quotes-for-event-registration-lead-retrieval-and-session-tracking-vendor/ NJSBA's Request for Quotes for Event Registration/Lead Retrieval and Session Tracking Vendor - New... Nov 28, 2023 - Advertisement for Quotes Request for Quotes (RFQ) for Virtual Conference Platform New Jersey School Boards Association Trenton, New Jersey The New Jersey... request for quotesevent registrationlead retrievalsession trackingnjsba https://best-ai.org/ai-news/lfm2-colbert-350m-unleashing-multilingual-rag-with-a-lean-mean-retrieval-machine-1761728479521 LFM2-ColBERT-350M: Unleashing Multilingual RAG with a Lean, Mean Retrieval Machine | Best-AI.org |... Oct 29, 2025 - LFM2-ColBERT-350M is a compact yet powerful language model revolutionizing multilingual RAG by enabling efficient and accurate information retrieval across... with abest aicolbertmultilingualrag https://papers.neurips.cc/paper_files/paper/2025/hash/1a93178950e92fd2e7b7448f7d68fd7d-Abstract-Datasets_and_Benchmarks_Track.html Benchmarking Retrieval-Augmented Multimomal Generation for Document Question Answering question answeringbenchmarkingretrievalaugmentedgeneration https://www.handbook.unsw.edu.au/postgraduate/courses/2026/comp6714 Handbook - Information Retrieval and Web Search The UNSW Handbook is your comprehensive guide to degree programs, specialisations, and courses offered at UNSW. information retrievalweb searchhandbook https://research.ibm.com/publications/benchmarking-and-building-zero-shot-hindi-retrieval-model-with-hindi-beir-and-nllb-e5 Benchmarking and Building Zero-Shot Hindi Retrieval Model with Hindi-BEIR and NLLB-E5 for NAACL... Benchmarking and Building Zero-Shot Hindi Retrieval Model with Hindi-BEIR and NLLB-E5 for NAACL 2025 by Arkadeep Acharya et al. zero shotbenchmarkingbuildinghindiretrieval https://www.codersarts.com/post/why-hybrid-search-and-re-ranking-is-the-retrieval-skill-every-ai-developer-needs Why Hybrid Search and Re-Ranking Is the Retrieval Skill Every AI Developer Needs Mar 19, 2026 - Discover why Hybrid Search and Re-Ranking is the retrieval skill every AI developer needs. Learn to fix retrieval issues with Hybrid Search and Re-Ranking. hybrid searchai developerrankingretrievalskill https://www.capitalhealth.org/news/clot-retrieval-procedures-offer-critical-early-option-for-ischemic-stroke-patients Clot Retrieval Procedures Offer Critical, Early Option for Ischemic Stroke Patients | Capital... National guidelines focus on importance of evaluating all treatment options and triaging by EMS Early treatment of acute ischemic stroke changed dramatically... ischemic strokeclotretrievalproceduresoffer https://learn.microsoft.com/en-us/answers/questions/2156525/scanning-salesforce-with-microsoft-purview-access Scanning Salesforce with Microsoft Purview: Access Token Retrieval Error - Microsoft Q&A I am trying to scan a demo Salesforce system that is publicly available over the internet (so no SHIR needed as I see it). However, even when trying out the... microsoft purviewaccess tokenscanningsalesforceretrieval https://publicism.info/magic/books/crystal/38.html Spirit attachment - Soul Retrieval and Spirit Release Listing over 1,200 symptoms, this is a practical first-aid guide based on sound crystal-healing principles that have been practiced for millennia. Crystals are... spiritattachmentsoulretrievalrelease https://www.007names.com/account/recover.xhtml;jsessionid=1E574821E4FF563924D0ADB1B32BA4B3 Login Retrieval 007names account recovery retrieval https://eudl.eu/doi/10.4108/icst.pervasivehealth.2015.259184 Case-based retrieval of similar diabetic patients - EUDL Patients suffering from diabetes often develop several comorbidities such as hypertension and dyslipidemia. The presence of the comorbidities leads to more... casebasedretrievalsimilardiabetic https://bookmarksea.com/story19992140/leadgenhero-your-all-in-one-lead-retrieval-solution LeadGenHero : Your All-in-One Lead Retrieval Solution all in onelead retrievalsolution https://pure.psu.edu/en/publications/misspoken-words-affect-the-perception-and-retrieval-of-intended-w/ Misspoken words affect the perception and retrieval of intended words - Penn State penn statewordsaffectperceptionretrieval https://docs.pebbleai.app/flowise/integrations/langchain/chains/multi-retrieval-qa-chain Multi Retrieval QA Chain - PebbleAI QA Chain that automatically picks an appropriate vector store from multiple retrievers. multiretrievalqachain https://www.ijsr.net/getabstract.php?paperid=SUB14483 A Review - Translation, Rotation and Scale-Invariant Image Retrieval While bag-of-features (BOF) models have been widely applied for addressing image retrieval problems, the resulting performance is typically limited due to its d a reviewtranslationrotationscaleinvariant https://eprints.whiterose.ac.uk/id/eprint/136517/ S.N. Eisenstadt and African modernities: Dialogue, extension, retrieval - White Rose Research Online s nwhite roseresearch onlineeisenstadtafrican https://sarit.indology.info/exist/apps/sarit/works/ugraditya-kalyanakaraka.xml?root=1.5.2.4.36&view=page SARIT: Search and Retrieval of Indic Texts (New) searchretrievaltextsnew https://karachinews.com.pk/news/cda-suspends-land-retrieval-drive-after-pm-halts-skyscraper-action/ CDA suspends Land retrieval drive after PM halts skyscraper action - karachinews.com.pk ISLAMABAD: The Capital Development Authority (CDA) has temporarily suspended its operations against informal settlements in Islamabad following widespread... cdalandretrievaldrivepm https://vu.fernuni-hagen.de/lvuweb/lvu/app/Kurs/1879/WS2022?function=Start Virtueller Studienplatz - 01879 Information Retrieval (WiSe 22/23) (Portal) Virtueller Studienplatz information retrievalwiseportal https://liner.com/review/automatic-retrieval-similar-content-using-search-engine-query-interface Automatic retrieval of similar content using search engine query interface [Quick Review] Regarding this CIKM 2009 paper, this review summarizes an automated method for content similarity validation using a randomized query generation approach. search enginequick reviewautomaticretrievalsimilar https://bactra.org/notebooks/text-mining.html Text Mining (and Information Retrieval) text mininginformation retrieval https://espnaudio.espn.com/ External ESPN Audio Retrieval System externalespnaudioretrievalsystem https://www.aicrowd.com/challenges/meta-comprehensive-rag-benchmark-kdd-cup-2024/problems/meta-kdd-cup-24-crag-knowledge-graph-and-web-retrieval/leaderboards?challenge_leaderboard_extra_id=1372&challenge_round_id=1356 AIcrowd | Meta KDD Cup 24 - CRAG - Knowledge Graph and Web Retrieval | Leaderboards Evaluating RAG Systems With Mock KGs and APIs knowledge graphmetakddcupcrag https://www.catalyzex.com/paper/beyond-closed-pool-video-retrieval-a Beyond Closed-Pool Video Retrieval: A Benchmark and Agent Framework for Real-World Video Search and... Beyond Closed-Pool Video Retrieval: A Benchmark and Agent Framework for Real-World Video Search and Moment Localization: Paper and Code. Traditional video... agent frameworkfor realbeyondclosedpool https://oulurepo.oulu.fi/handle/10024/29183 Information retrieval and awareness about evidence-based dentistry among dental undergraduate... evidence based dentistryinformation retrievalawarenessamongdental https://www.uspto.gov/system-status/current-events1105 TSDR (Trademark Status and Document Retrieval) documentsUnavailability | USPTO TSDR (Trademark Status and Document Retrieval) documentsUnavailability The USPTO is currently experiencing technical difficulties with TSDR anduser may be... trademark statusdocument retrievaltsdruspto https://publications.idiap.ch/publications/show/1896 The ACLD: Speech-based Just-in-Time Retrieval of Meeting Transcripts, Documents and Websites -... just in timemeeting transcriptsspeechbasedretrieval https://publications-cnrc.canada.ca/eng/view/object/?id=a7c3978e-ba48-442f-83ce-c5cfa9198ed5 Automatic retrieval and dissemination - NRC Publications Archive - Canada.ca Automatic retrieval and dissemination publications archiveautomaticretrievaldisseminationnrc https://visualping.io/pages/direct-safe-endovascular-clot-retrieval-clinical-trial-alerts-4961454 DIRECT-SAFE: Endovascular Clot Retrieval Clinical Trial: Get alerts for the latest updates -... See the latest updates to DIRECT-SAFE: Endovascular Clot Retrieval Clinical Trial. Subscribe for free to get alerts when changes are detected to DIRECT-SAFE:... for the latestclinical trialget alertsdirectsafe https://medinform.jmir.org/2026/1/e82026 JMIR Medical Informatics - Multi-Evidence Clinical Reasoning With Retrieval-Augmented Generation... Background: Emergency triage accuracy is critical but varies with clinician experience, cognitive load, and case complexity. Mis-triage can delay care for... medical informaticsclinical reasoningjmirmultievidence https://suryahospitals.com/santacruz/services/department-of-ivf/fertility-treatments/treatment/sperm-retrieval-techniques Best Sperm Retrieval Techniques Services Near Me: Serving in Santacruz-Mumbai, India Looking for trusted Sperm Retrieval Techniques care near you? Our hospital offers comprehensive services in Santacruz-Mumbai, India. Schedule your appointment... services near mesperm retrievalbesttechniquesserving https://researchconnect.buffalo.edu/en/publications/a-probabilistic-method-for-keyword-retrieval-in-handwritten-docum/ A probabilistic method for keyword retrieval in handwritten document images - SUNY University at... probabilisticmethodkeywordretrievalhandwritten https://cris.vtt.fi/en/publications/text-to-multimodal-retrieval-with-bimodal-input-fusion-in-shared-/fingerprints/ Text-to-Multimodal Retrieval with Bimodal Input Fusion in Shared Cross-Modal Transformer -... textmultimodalretrievalbimodalinput https://www.itsgloria.ai/news/qdrant-raises-50m-in-series-b-releases-platform-version-117-to-enhance-ai-retrie-7010b155-0f46-47b4-9de2-9f59ea2d4815 Qdrant raises $50M in Series B, releases platform version 1.17 to enhance AI retrieval capabilities... Qdrant, a Berlin-based open-source vector search company, recently announced a successful $50 million Series B funding round aimed at enhancing its... in seriesplatform versionqdrantbreleases https://microship.com/online-information-retrieval-promise-and-problems-byte/online-information-retrieval-7/ Online Information Retrieval - 7 - Nomadic Research Labs online informationresearch labsretrievalnomadic https://www.pluralsight.com/courses/sql-server-advanced-data-retrieval-techniques Advanced Data Retrieval Techniques in SQL Server advanced datasql serverretrievaltechniques https://spiral.lynn.edu/facpubs/2129/ "Optional Review Activities with Retrieval Practice Improve Learning an" by Melissa Lehman This study examines the impact of an optional retrieval practice activity on retention of content and its effect on test anxiety in an undergraduate course.... retrieval practiceimprove learningoptionalreviewactivities https://community.developers.lseg.com/discussion/102573/receiving-an-error-from-rfa-rfa-exception-omminvalidusageexception-dictionary-retrieval-failed Receiving an error from RFA : RFA Exception OmmInvalidUsageException dictionary retrieval failed... ...(timed out after waiting 45000 milliseconds) Do you know how to configure my RFA to use local field dictionary file instead of downloading that from... receivingerrorrfaexceptiondictionary https://sureprompts.com/blog/rag-prompt-engineering-guide RAG Prompt Engineering: How to Write Prompts That Work With Retrieval-Augmented Generation (2026) |... Apr 12, 2026 - Your RAG system is only as good as its prompts. Learn how to write system prompts, query prompts, and synthesis prompts that make retrieval-augmented... how to writeprompt engineeringwork withragprompts https://scholars.uky.edu/es/publications/endovascular-retrieval-of-an-intraaortic-greenfield-vena-cava-fil/ Endovascular retrieval of an intraaortic Greenfield vena cava filter - endovascularretrievalgreenfieldvenacava https://www.fi.freelancer.com/projects/api/document-retrieval-automation Document Retrieval Automation | Freelancer document retrievalautomationfreelancer https://researchrepository.universityofgalway.ie/entities/publication/532917d0-a8cc-4874-88dc-b1eedc4d7650 Age-related task sensitivity of frontal EEG entropy during encoding predicts retrieval Age-related declines in memory may be due in part to changes in the complexity of neural activity in the aging brain. Electrophysiological entropy provides an... agerelatedtasksensitivityfrontal https://help.salesforce.com/s/articleView?id=ind.hc_admin_contact_center_agent_topic_patient_data_rtrv.htm&language=en_US&type=5 Subagent: Patient Data Retrieval Provides contact center reps with real-time patient data from external EMR systems by using the US Core Data Set(USCDI) FHIR APIs during patient interacti... patient datasubagentretrieval https://www.edplace.com/worksheet/english/keystage2/year6/topic/1387/exam-style-questions:-retrieval-questions/ Exam-Style Questions: Retrieval Questions Year 6 Worksheets (KS 2) - EdPlace keystage 2 Interactive Worksheets to help your child understand Exam-Style Questions: Retrieval Questions in English Year 6. Education resources, designed... examstylequestionsretrievalyear https://community.logicmonitor.com/forum/feature-requests-41/topic/enable-retrieval-of-device-list-by-system-group-in-the-lm-ansible-lm_info-module-406/?focus_post=399 Enable retrieval of device list by system group in the LM Ansible lm_info module | Feature Requests... Feb 1, 2023 - Need to be able to get devices for a particular group in LM using the ansible lm_info module.Seems a reasonable expectation.Example: - name:... device listby systemfeature requestsenableretrieval https://codanics.com/courses/python-ka-chilla-2024/lesson/rag-retrieval-augmented-generation-explained-for-llms-2/ RAG (Retrieval-Augmented Generation) Explained for LLMs - Codanics for llmsragretrievalaugmentedgeneration https://lrec.elra.info/lrec2006-main-390 Exploiting Dynamic Passage Retrieval for Spoken Question Recognition and Context Processing towards... May 1, 2006 - Speech interfaces and dialogue processing abilities have promise for improving the utility of open-domain question answering (QA).We propose a novel method of r exploitingdynamicpassageretrievalspoken https://www.deeplearning.ai/alpha/short-courses/advanced-retrieval-for-ai Advanced Retrieval for AI with Chroma - DeepLearning.AI Learn advanced retrieval techniques to improve the relevancy of retrieved results. Learn to recognize poor query results and use LLMs to improve queries. for aiadvancedretrievalchromadeeplearning https://lore.list.lu/dataset.xhtml?persistentId=perma:LIST.ESUPZZ Ecophysiological variables retrieval and early stress detection: insights from a synthetic spatial... Sep 26, 2025 - The ability to access physiologically driven signals, such as surface temperature, photochemical reflectance index (PRI), and sun-induced chlorophyll... variablesretrievalearlystressdetection https://docs.vultr.com/problem-set/parallel-execution-of-promises-for-individual-results-retrieval 2795. Parallel Execution of Promises for Individual Results Retrieval - Solutions and Explanation |... parallel executionfor individualpromisesresultsretrieval https://cris.iucc.ac.il/en/publications/do-age-related-word-retrieval-difficulties-appear-or-disappear-in/ Do age-related word retrieval difficulties appear (or disappear) in connected speech? - Israeli... agerelatedwordretrievaldifficulties https://dbis.cs.unibas.ch/teaching/studentprojects/representative-viewpoint-selection-for-3d-model-retrieval/ Representative Viewpoint Selection for 3D Model Retrieval - DBIS, University of Basel Home Teaching Student Projects Representative Viewpoint Selection for 3D Model Retrieval university of baselrepresentativeviewpointselectionmodel https://research.utwente.nl/en/publications/mesh-up-effective-mesh-text-classification-for-improved-document-/ MeSH Up: effective MeSH text classification for improved document retrieval - University of Twente... university of twentetext classificationdocument retrievalmesheffective https://www3.erie.gov/purchasing/form/on-line-bid-retrieval On-line Bid Retrieval | Purchasing on linebidretrievalpurchasing