https://www.seattlethread.com/
Men's Business Casual Clothing, Shoes, Gifts, Basics, Accessories – Seattle Thread Company
Shop contemporary, designer and classic men's casual and business casual clothing, outerwear, shoes, gifts, and accessories. The best in fit, fashion, and...
seattle thread companybusiness casualmenclothingshoes
https://www.seattlethread.com/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts
AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company
The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian...
ag adriano goldschmiedseattle thread companygriffinlightweightstretch
https://www.seattlethread.com/products/34-heritage-courage-dark-midnight-brushed-urban?variant=49035131257078
34 Heritage Courage Straight Fit Urban Wash Jeans – Seattle Thread Company
Elevate any occasion in this pair of sleek, dark-wash jeans cut from denim with a luxe look and feel. Made for movement with a higher proportion of elastance,...
seattle thread companystraight fitheritagecourageurban
https://www.seattlethread.com/products/albertostone1572modernfitdynamicsuperfitstretchdenimjeans
Alberto Stone 1572 Modern Fit Dynamic Superfit Stretch Denim Jeans – Seattle Thread Company
These clean-wash black denim jeans from Alberto are the perfect wardrobe staple! The soft stretch black denim fabric is flexible and comfortable for all-day...
seattle thread companystretch denimalbertostonemodern
https://www.seattlethread.com/collections/lorenzo-uomo
Lorenzo Uomo – Seattle Thread Company
seattle thread companylorenzo uomo
https://www.seattlethread.com/collections/scott-barber
Scott Barber – Seattle Thread Company
seattle thread companyscott barber
https://www.seattlethread.com/collections/sale/products/ag-adriano-goldschmied-wanderer-lightweight-stretch-shorts?variant=45046869819638
AG Adriano Goldschmied Wanderer Lightweight Stretch Shorts – Seattle Thread Company
The AG Wanderer Short for men has a slim fit with a clean trouser look and a slightly tapered leg opening. This men’s short is designed in 7.4 oz. Brighton...
ag adriano goldschmiedseattle thread companywandererlightweightstretch
https://www.seattlethread.com/policies/shipping-policy
Shipping policy – Seattle Thread Company
seattle thread companyshipping policy
https://www.seattlethread.com/collections/sale/products/brax-evans-tripe-stone-cotton-chino-pants?variant=47318103589110
BRAX Evans Triple Stone Stretch Cotton Chino Pants – Seattle Thread Company
A midweight, sturdy, and soft cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate for work and everyday...
seattle thread companystretch cottonchino pantsbraxevans
https://www.seattlethread.com/products/claebradleymidcocoaleathersneakers
CLAE Bradley Mid Cocoa Oiled Leather Sneakers – Seattle Thread Company
A classic mid-top sneaker refined onto a premium, minimalistic silhouette, the Bradley Mid created by CLAE is as simple as it is functional. Crafted with fine...
seattle thread companyleather sneakersclaebradleymid
https://www.seattlethread.com/products/alberto-pipe-1942-regular-fit-dual-tone-ceramica-5-pocket-pants
Alberto Pipe 1942 Regular Fit Dual Tone Ceramica 5 Pocket Pants – Seattle Thread Company
These are Alberto Pipe Ceramica 5 Pocket pants featuring a soft and comfortable dual-tone weave fabric. Alberto Pipe Regular Fit Ceramica Temperature...
seattle thread companyregular fitdual tonealbertopipe
https://www.seattlethread.com/products/alberto-pipe-1577-regular-fit-light-tencel-stretch-jeans?variant=44811948392694
Alberto Pipe 1577 Regular Fit Lightweight Stretch Tencel Jeans – Seattle Thread Company
Alberto Pipe Regular Fit jeans constructed using Alberto's best-selling Light Tencel Stretch Denim. This is a thin and lightweight tencel blend denim that is...
seattle thread companyregular fitalbertopipelightweight
https://www.seattlethread.com/collections/all
Products – Seattle Thread Company
seattle thread companyproducts
https://www.seattlethread.com/products/ag-adriano-goldschmied-graduate-all-direction-stretch-denim-jeans
AG Adriano Goldschmied Graduate All Direction Stretch Denim Jeans – Seattle Thread Company
Premium stretch denim with advanced flexibility and modern construction. This off-duty essential offsets a relaxed waist with a tailored leg in a midnight-blue...
ag adriano goldschmiedseattle thread companystretch denimgraduatedirection
https://www.seattlethread.com/collections/lounge
Lounge – Seattle Thread Company
Kick back and relax with our outstanding collection of soft and comfortable casual threads! From underwear to joggers to tees and hoodies, we have you covered!
seattle thread companylounge
https://www.seattlethread.com/collections/jackets-outerwear
Jackets & Outerwear – Seattle Thread Company
seattle thread companyjacketsouterwear
https://www.seattlethread.com/products/relwen-canvas-chore-coat?variant=47787294621942
Relwen Canvas Chore Coat – Seattle Thread Company
New this season, this design is Relwen's take on the classic utility-driven chore coat design. Relwen has refined the usual design and has opted for something...
seattle thread companychore coatrelwencanvas
https://www.seattlethread.com/collections/geox
Geox – Seattle Thread Company
In 1995 Geox took Italy by storm, creating men's shoes that feature bold colors and contemporary designs while combining fashion and comfort. Today, Geox has...
seattle thread companygeox
https://www.seattlethread.com/products/albertopipe1572regularfitdynamicsuperfitstretchdenimjeans?variant=36308433633442
Alberto Pipe 1572 Regular Fit Dynamic Superfit Stretch Denim Jeans – Seattle Thread Company
These clean-wash black denim jeans from Alberto are the perfect wardrobe staple! The soft stretch black denim fabric is flexible and comfortable for all-day...
seattle thread companyregular fitstretch denimalbertopipe
https://www.seattlethread.com/products/7-diamonds-bosworth-stretch-performance-shirt?variant=50109774856438
7 Diamonds Bosworth Stretch Performance Shirt – Seattle Thread Company
A classic button-up crafted in Lido Stretch fabric featuring HD digital prints, custom 7D debossed taping, a hidden button-down collar, finished with a chest...
seattle thread companyperformance shirtdiamondsbosworthstretch
https://www.seattlethread.com/collections/sale/products/alberto-pipe-1837-premium-soft-flannel-ceramica-regular-fit-5-pocket-pants?variant=47212212289782
Alberto Pipe 1837 Premium Soft Flannel Ceramica Regular Fit 5-Pocket P – Seattle Thread Company
A long standing brand, Alberto has been a family company since 1922. By creating styles utilizing generations of expertise, technological innovation, and high...
seattle thread companyregular fitalbertopipepremium
https://www.seattlethread.com/collections/rodd-gunn?filter.p.product_type=Shoes&filter.v.price.gte=&filter.v.price.lte=&filter.v.availability=1
Rodd & Gunn – Seattle Thread Company
seattle thread companygunn
https://www.seattlethread.com/collections/chelsea
Chelsea – Seattle Thread Company
seattle thread companychelsea
https://www.seattlethread.com/products/bruun-stengade-saturn-wool-modal-blend-turtleneck-sweater
Bruun & Stengade Saturn Wool Modal Blend Turtleneck Sweater – Seattle Thread Company
seattle thread companyturtleneck sweatersaturnwoolmodal
https://www.seattlethread.com/products/7-diamonds-solaro-stretch-performance-polo?variant=50109729439990
7 Diamonds Solaro Stretch Performance Polo – Seattle Thread Company
Luxury minimalism was the angle taken for the Solaro Polo. Textured knit design, 7D Pearl buttons, side vents and sew-in collar stays. These elevated subtle...
seattle thread companyperformance polodiamondssolarostretch
https://www.seattlethread.com/collections/clae
CLAE – Seattle Thread Company
seattle thread companyclae
https://www.seattlethread.com/products/clae-joshua-light-sneakers
CLAE Joshua Light Sneakers – Seattle Thread Company
100% Vegan and crafted from 70% recycled materials, our signature trainers have been reimagined with sleek lines and subtle detailing. Recycled synthetic and...
clae joshua light sneakersseattle thread company
https://www.seattlethread.com/products/anchor-crew-orla-silver-and-nappa-leather-bracelet?variant=46982494290166
Anchor & Crew Orla Silver and Nappa Leather Bracelet – Seattle Thread Company
The Orla Silver and Nappa Leather Bracelet was both designed and skilfully handcrafted completely in Great Britain. Combining British craft manufacturing with...
seattle thread companynappa leatheranchorcreworla
https://www.seattlethread.com/collections/sale/products/bruun-stengade-tusk-slim-fit-houndstooth-woven-pattern-dress-shirt?variant=44455838580982
Bruun & Stengade Tusk Slim Fit Woven Pattern Dress Shirt – Seattle Thread Company
seattle thread companyslim fitdress shirt
https://www.seattlethread.com/collections/gifts-accessories
Gifts & Accessories – Seattle Thread Company
seattle thread companygifts accessories
https://www.seattlethread.com/products/alberto-pipe-1383-regular-fit-dynamic-superfit-colored-denim-jeans
Alberto Pipe 1383 Regular Fit Dynamic Superfit Colored Denim Jeans – Seattle Thread Company
These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly...
seattle thread companyregular fitcolored denimalbertopipe
https://www.seattlethread.com/products/blujackettannertrimfitnanotexwooldresspants
BluJacket Tanner Trim Fit Nanotex Wool Dress Pants – Seattle Thread Company
Exceptional fabrics, exceptional style. BluJacket uses a fabric blend of 97% wool and 3% cashmere to make this suit smooth and soft to the touch. Nanotex is a...
seattle thread companydress pantstannertrimfit
https://www.seattlethread.com/products/7-diamonds-renzo-stretch-performance-shirt?variant=50109726458102
7 Diamonds Renzo Stretch Performance Shirt – Seattle Thread Company
A classic button-up crafted in Lido Stretch fabric featuring HD digital prints, custom 7D debossed taping, a hidden button-down collar, finished with a chest...
seattle thread companyperformance shirtdiamondsrenzostretch
https://www.seattlethread.com/collections/billy-reid
Billy Reid – Seattle Thread Company
Billy Reid grew up in Amite, Louisiana where his mother owned a women’s boutique in the hospitable environs of his grandmother’s former home. That early...
seattle thread companybilly reid
https://www.seattlethread.com/products/alberto-pipe-1489-regular-fit-super-stretch-colored-denim-jeans?variant=48890379927798
Alberto Pipe 1489 Regular Fit Super Stretch Colored Denim – Seattle Thread Company
These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly...
seattle thread companyregular fitsuper stretchcolored denimalberto
https://www.seattlethread.com/collections/sale?filter.p.product_type=Knit+SS&filter.p.product_type=Shirt+SS&filter.p.product_type=T-Shirt&filter.v.availability=1
Sale Collection – Seattle Thread Company
seattle thread companysale collection
https://www.seattlethread.com/products/relwen-heavyweight-ringspun-pocket-tee
Relwen Ringspun Pocket Tee – Seattle Thread Company
A premium everyday T-shirt made from soft ring-spun cotton with a substantial midweight feel. Inspired by classic athletic tees from the 1960s and 70s, it...
relwen ringspun pocket teeseattle thread company
https://www.seattlethread.com/products/alberto-lou-j-1919-regular-fit-textured-cotton-chino-pants
Alberto Lou-J 1919 Regular Fit Textured Cotton Chino Pants – Seattle Thread Company
These Alberto Lou Regular Fit Chinos are made with a lightweight woven two-tone birdseye cotton fabric -- these chinos are comfortable and stylish. A wardrobe...
seattle thread companyregular fitchino pantsalbertolou
https://www.seattlethread.com/collections/sale/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts?variant=43051889230070
AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company
The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian...
ag adriano goldschmiedseattle thread companygriffinlightweightstretch
https://www.seattlethread.com/collections/renoir
Pellagio & Renoir – Seattle Thread Company
seattle thread companyrenoir
https://www.seattlethread.com/collections/sale/products/billy-reid-pickwick-grid-plaid-soft-brushed-shirt?variant=49269232959734
Billy Reid Pickwick Grid Plaid Soft Brushed Shirt – Seattle Thread Company
This classic shirt style features a spread collar with collar stays, our signature spade pocket with single-needle stitching, barrel cuffs, a French placket,...
seattle thread companybilly reidbrushed shirtpickwickgrid
https://www.seattlethread.com/pages/tailored-clothing
Custom Tailored Clothing – Seattle Thread Company
custom tailored clothingseattle thread company
https://www.seattlethread.com/collections/alberto
Alberto – Seattle Thread Company
One of the top-selling brands of jeans and pants in Europe, Alberto is a highly regarded product for the discerning man. There is simply no comparison in terms...
seattle thread companyalberto
https://www.seattlethread.com/collections/bruun-stengade
Bruun & Stengade – Seattle Thread Company
seattle thread company
https://www.seattlethread.com/collections/sale/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts?variant=43226904789238
AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company
The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian...
ag adriano goldschmiedseattle thread companygriffinlightweightstretch
https://www.seattlethread.com/collections/cologne
Grooming & Cologne – Seattle Thread Company
seattle thread companygroomingcologne
https://www.seattlethread.com/products/7-diamonds-everest-hybrid-shorts?variant=45226046226678
7 Diamonds Everest Hybrid Technical Shorts – Seattle Thread Company
These 4-way stretch hybrid shorts are a cut above the rest. The signature 7Diamonds contrast tape detail and quick dry fabric, perform as well in water as it...
seattle thread companytechnical shortsdiamondseveresthybrid
https://www.seattlethread.com/collections/scarves
Scarves – Seattle Thread Company
seattle thread companyscarves
https://www.seattlethread.com/collections/sale/products/billy-reid-linen-flat-front-trouser?variant=50345348399350
Billy Reid Linen Flat Front Trouser – Seattle Thread Company
The Billy Reid Flat Front Trouser is refreshed in a luxe, lightweight linen for breathable comfort. This rendition has the same mid-rise and slim-fit...
seattle thread companybilly reidflat frontlinentrouser
https://www.seattlethread.com/collections/fulton-roark
Fulton & Roark – Seattle Thread Company
seattle thread companyfultonroark
https://www.seattlethread.com/products/bruun-stengade-edvald-slim-fit-texture-woven-dress-shirt
Bruun & Stengade Edvald Slim Fit Texture Woven Dress Shirt – Seattle Thread Company
seattle thread companyslim fitdress shirt
https://www.seattlethread.com/collections/sale/products/clae-joshua-sneakers?variant=46173077471478
CLAE Joshua Light Trainer Sneakers – Seattle Thread Company
100% Vegan and crafted from 70% recycled materials, our signature trainers have been reimagined with sleek lines and subtle detailing. Recycled synthetic and...
seattle thread companyclaejoshualighttrainer
https://www.seattlethread.com/products/ag-adriano-goldschmied-graduate-all-direction-stretch-denim-jeans?variant=6722712773
AG Adriano Goldschmied Graduate All Direction Stretch Denim Jeans – Seattle Thread Company
Premium stretch denim with advanced flexibility and modern construction. This off-duty essential offsets a relaxed waist with a tailored leg in a midnight-blue...
ag adriano goldschmiedseattle thread companystretch denimgraduatedirection
https://www.seattlethread.com/collections/sale/products/borelio-napoli-overshirt?variant=46205807821046
Borelio Napoli Garment Dye Cotton Overshirt – Seattle Thread Company
Borélio is a European workshop specializing in casual sartorial tailoring using the world's finest mills. They have been an EU industry leader for over 20...
seattle thread companygarment dyenapolicottonovershirt
https://www.seattlethread.com/collections/sale/products/brax-chuck-modern-fit-hi-flex-lightweight-5-pocket-pants?variant=46206543429878
BRAX Chuck Modern Fit Hi-Flex Lightweight 5 Pocket Pants – Seattle Thread Company
A lightweight and soft sueded cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate with your next warm...
seattle thread companybraxchuckmodernfit
https://www.seattlethread.com/products/relwen-fineline-jersey-polo?variant=50549391360246
Relwen Fineline Jersey Polo – Seattle Thread Company
Relwen’s take on the classic polo, the Fineline Jersey Polo, is crafted from a finespun jersey cotton that’s light and airy for long days in warm weather. Look...
relwen fineline jersey poloseattle thread company
https://www.seattlethread.com/collections/smith
Smith – Seattle Thread Company
seattle thread companysmith
https://www.seattlethread.com/collections/7-diamonds
7 Diamonds – Seattle Thread Company
seattle thread companydiamonds
https://www.seattlethread.com/collections/marine-layer
Marine Layer – Seattle Thread Company
seattle thread companymarine layer
https://www.seattlethread.com/collections/sale?filter.p.product_type=Sport+Coat&filter.p.product_type=Sport+Coat+Unstructured&filter.p.product_type=Suit&filter.v.availability=1
Sale Collection – Seattle Thread Company
seattle thread companysale collection
https://www.seattlethread.com/pages/shipping
International Shipping – Seattle Thread Company
All products ship from the US, and we are based in the US. International Shipping is available during checkout for the following destinations: - Canada -...
seattle thread companyinternational shipping
https://www.seattlethread.com/collections/shorts
Shorts – Seattle Thread Company
Flat front shorts and cargo shorts
seattle thread companyshorts
https://www.seattlethread.com/products/clae-malone-leather-court-sneakers
CLAE Malone Leather Court Sneakers – Seattle Thread Company
Handcrafted with fine leathers on CLAE's Premium Court sole (PC) Cushioned heel counter emphasizes support EVA insole for extra comfort
seattle thread companyclaemaloneleathercourt
https://www.seattlethread.com/collections/evolg
Evolg – Seattle Thread Company
seattle thread companyevolg
https://www.seattlethread.com/products/alberto-pipe-1489-regular-fit-super-stretch-colored-denim-jeans
Alberto Pipe 1489 Regular Fit Super Stretch Colored Denim – Seattle Thread Company
These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly...
seattle thread companyregular fitsuper stretchcolored denimalberto
https://www.seattlethread.com/products/alberto-pipe-1577-regular-fit-light-tencel-stretch-jeans?variant=48039330283766
Alberto Pipe 1577 Regular Fit Lightweight Stretch Tencel Jeans – Seattle Thread Company
Alberto Pipe Regular Fit jeans constructed using Alberto's best-selling Light Tencel Stretch Denim. This is a thin and lightweight tencel blend denim that is...
seattle thread companyregular fitalbertopipelightweight
https://www.seattlethread.com/products/relwen-heavyweight-ringspun-pocket-tee?variant=50087075676406
Relwen Ringspun Pocket Tee – Seattle Thread Company
A premium everyday T-shirt made from soft ring-spun cotton with a substantial midweight feel. Inspired by classic athletic tees from the 1960s and 70s, it...
relwen ringspun pocket teeseattle thread company
https://www.seattlethread.com/collections/sale/products/borelio-kenia-safari-jacket?variant=46205866017014
Borelio Kenia Garment Dye Cotton Safari Jacket – Seattle Thread Company
Borélio is a European workshop specializing in casual sartorial tailoring using the world's finest mills. They have been an EU industry leader for over 20...
seattle thread companygarment dyekeniacottonsafari
https://www.seattlethread.com/products/alberto-pipe-1837-premium-soft-flannel-ceramica-regular-fit-5-pocket-pants
Alberto Pipe 1837 Premium Soft Flannel Ceramica Regular Fit 5-Pocket P – Seattle Thread Company
A long standing brand, Alberto has been a family company since 1922. By creating styles utilizing generations of expertise, technological innovation, and high...
seattle thread companyregular fitalbertopipepremium
https://www.seattlethread.com/collections/pikolinos
Pikolinos – Seattle Thread Company
seattle thread companypikolinos
https://www.seattlethread.com/collections/bickley-mitchell
Bickley + Mitchell – Seattle Thread Company
Bickley + Mitchell specializes in knitwear products for men + women. They are an Amsterdam based fashion brand founded in 2011 by a small group of creatives in...
seattle thread companybickleymitchell
https://www.seattlethread.com/collections/hoodies
Hoodies – Seattle Thread Company
seattle thread companyhoodies
https://www.seattlethread.com/cart
Your Shopping Cart – Seattle Thread Company
your shopping cartseattle thread company
https://www.seattlethread.com/collections/sale?filter.p.product_type=Shirt+LS&filter.p.product_type=Shirt+Dress&filter.v.availability=1
Sale Collection – Seattle Thread Company
seattle thread companysale collection
https://www.seattlethread.com/collections/rails
Rails – Seattle Thread Company
seattle thread companyrails
https://www.seattlethread.com/products/brax-evans-tripe-stone-cotton-chino-pants
BRAX Evans Triple Stone Stretch Cotton Chino Pants – Seattle Thread Company
A midweight, sturdy, and soft cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate for work and everyday...
seattle thread companystretch cottonchino pantsbraxevans
https://www.seattlethread.com/collections/sale/products/brax-chuck-modern-fit-hi-flex-colored-denim-pants?variant=49105130094838
BRAX Chuck Modern Fit Hi-Flex Pants – Seattle Thread Company
A sturdy midweight colored denim stretch fabric 5 pocket pant from BRAX. The fabric has a slight wash for tonal effects and dimension. These run very true to...
seattle thread companybraxchuckmodernfit
https://www.seattlethread.com/products/relwen-flyweight-flex-blazer?variant=50083051176182
Relwen Flyweight Flex Blazer – Seattle Thread Company
A relaxed take on the traditional blazer, designed with the durability and comfort of a field jacket. This versatile piece can be worn casually or dressed up,...
relwen flyweight flex blazerseattle thread company
https://www.seattlethread.com/collections/sale/products/ag-adriano-goldschmied-tellis-commuter-performance-sateen-pants?variant=44960892584182
AG Adriano Goldschmied Tellis Airluxe Commuter Performance Sateen Pant – Seattle Thread Company
The Tellis is a modern slim fit updated in our new 10 oz. Commuter Performance Sateen with premium stretch for enhanced mobility. Featuring a fitted upper...
ag adriano goldschmiedseattle thread companytellisairluxecommuter
https://www.seattlethread.com/products/ag-adriano-goldschmied-everett-slim-straight-all-direction-stretch-jeans
AG Adriano Goldschmied Everett Slim Straight All Direction Stretch Jea – Seattle Thread Company
Everett is a slim straight jean for men, offered in a dark wash stretch denim. The Everett has a comfortable mid-rise waist and a straight fit that’s relaxed...
ag adriano goldschmiedseattle thread companyslim straighteverettdirection
https://www.seattlethread.com/pages/returns
Returns – Seattle Thread Company
seattle thread companyreturns
https://www.seattlethread.com/products/7-diamonds-rafael-stretch-performance-shirt
7 Diamonds Rafael Stretch Performance Shirt – Seattle Thread Company
A standout shirt that’s easy to wear anywhere. The special textured fabric has a subtle, puckered look that gives it depth and style. Built with a hidden...
seattle thread companyperformance shirtdiamondsrafaelstretch
https://www.seattlethread.com/products/relwen-flyweight-flannel-woven-shirt
Relwen Flyweight Flannel Woven Shirt – Seattle Thread Company
Yarn-dyed lightweight flannel, a fresh twist on fall but without the weight. With its light weight, this is the ultimate soft and comfortable fall-weather...
seattle thread companyrelwenflyweightflannelwoven
https://www.seattlethread.com/products/bailey-1922-balans-roll-up-travel-hat
Bailey 1922 Balans Packable Fedora Hat – Seattle Thread Company
The Balans Roll Up is made for the traveler. Crafted from a very soft, lightweight braid, the Optimo crown allows it to be rolled and packed for any adventure...
seattle thread companyfedora hatbaileybalanspackable
https://www.seattlethread.com/products/barbour-nelson-linen-cotton-blend-ls-shirt
Barbour Nelson Linen Cotton Blend LS Shirt – Seattle Thread Company
Soft linen/cotton blend long sleeved tailored shirt in casual styling. 55% Linen, 45% CottonSingle 21's, Plain Weave, Enzyme Finish.Extra soft handle...
seattle thread companylinen cottonbarbournelsonblend
https://www.seattlethread.com/collections/shoes
Shoes – Seattle Thread Company
seattle thread companyshoes
https://www.seattlethread.com/collections/knits-polos
Polos & Knits – Seattle Thread Company
seattle thread companypolosknits
https://www.seattlethread.com/pages/stock-service-tailored-clothing
Stock Tailored Clothing – Seattle Thread Company
stock tailored clothingseattle thread company
https://www.seattlethread.com/pages/contact-us
Contact Us – Seattle Thread Company
Retail Location Address: 9 Lake Street, Kirkland, WA 98033 10am - 7pm, Monday - Sunday (425) 202 7732 Have a question? Send us a message with this form, or...
seattle thread companycontact us
https://www.seattlethread.com/pages/about-us
About Seattle Thread Company
seattle thread company
https://www.seattlethread.com/collections/anchor-crew
Anchor & Crew – Seattle Thread Company
seattle thread companyanchorcrew
https://www.seattlethread.com/products/alberto-lou-j-1822-regular-fit-textured-cotton-blend-chino-pants?variant=47212217893110
Alberto Lou-J 1822 Regular Fit Textured Cotton Blend Chino Pants – Seattle Thread Company
These Alberto Lou Regular Fit Chinos are made with an exceptionally soft midweight woven two-tone fabric for a textured wool look -- these chinos are...
seattle thread companyregular fitcotton blendchino pantsalberto
https://www.seattlethread.com/products/anchor-crew-padstow-bracelet
Anchor & Crew Padstow Bracelet – Seattle Thread Company
The Padstow Silver and Rope Bracelet was both designed and skillfully handcrafted completely in Great Britain. Combining British craft manufacturing with a...
seattle thread companyanchorcrewpadstowbracelet
https://www.seattlethread.com/collections/coal
Coal – Seattle Thread Company
Coal was founded on the belief that headwear is more than an accessory. It’s part of you, your identity, and your lifestyle. We build this idea into each of...
seattle thread companycoal
https://www.seattlethread.com/collections/bellroy
Bellroy – Seattle Thread Company
Started in 2010, the Bellroy design team wanted to construct a better, thinner wallet. With it's compact construction and high quality leather, Bellroy Wallets...
seattle thread companybellroy
https://www.seattlethread.com/collections/sale/products/alberto-stone-1393-modern-fit-t400-denim-jeans?variant=1299541688
Alberto Stone 1393 Modern Fit T400 Stretch Denim Jeans – Seattle Thread Company
This is the Alberto year-round clean wash T400 Stretch Denim Jeans in the Modern Fit with a straight leg. We have been stocking this style for 11 years and...
seattle thread companystretch denimalbertostonemodern
https://www.seattlethread.com/products/ag-adriano-goldschmied-everett-slim-straight-cloud-soft-jeans?variant=44302925234422
AG Adriano Goldschmied Everett Slim Straight Cloud Soft Jeans – Seattle Thread Company
Everett is a slim straight jean for men, offered in a mid wash denim. The Everett has a comfortable mid-rise waist and a straight fit that’s relaxed from hip...
ag adriano goldschmiedseattle thread companyslim straightcloud softeverett
https://www.seattlethread.com/collections/stance
Stance – Seattle Thread Company
Since 2009, Stance turned what was once an overlooked accessory into a fashion piece that encourages self-expression and creative originality that draws...
seattle thread companystance
https://www.seattlethread.com/collections/sale/products/bugatti-full-zip-track-jacket?variant=49039110537462
Bugatti Full Zip Track Jacket – Seattle Thread Company
A dual-tone woven track jacket from the Bugatti collection. 75% Cotton / 25% Polyester
bugatti full zip track jacketseattle thread company