Robuta

https://www.seattlethread.com/ Men's Business Casual Clothing, Shoes, Gifts, Basics, Accessories – Seattle Thread Company Shop contemporary, designer and classic men's casual and business casual clothing, outerwear, shoes, gifts, and accessories. The best in fit, fashion, and... seattle thread companybusiness casualmenclothingshoes https://www.seattlethread.com/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian... ag adriano goldschmiedseattle thread companygriffinlightweightstretch https://www.seattlethread.com/products/34-heritage-courage-dark-midnight-brushed-urban?variant=49035131257078 34 Heritage Courage Straight Fit Urban Wash Jeans – Seattle Thread Company Elevate any occasion in this pair of sleek, dark-wash jeans cut from denim with a luxe look and feel. Made for movement with a higher proportion of elastance,... seattle thread companystraight fitheritagecourageurban https://www.seattlethread.com/products/albertostone1572modernfitdynamicsuperfitstretchdenimjeans Alberto Stone 1572 Modern Fit Dynamic Superfit Stretch Denim Jeans – Seattle Thread Company These clean-wash black denim jeans from Alberto are the perfect wardrobe staple! The soft stretch black denim fabric is flexible and comfortable for all-day... seattle thread companystretch denimalbertostonemodern https://www.seattlethread.com/collections/lorenzo-uomo Lorenzo Uomo – Seattle Thread Company seattle thread companylorenzo uomo https://www.seattlethread.com/collections/scott-barber Scott Barber – Seattle Thread Company seattle thread companyscott barber https://www.seattlethread.com/collections/sale/products/ag-adriano-goldschmied-wanderer-lightweight-stretch-shorts?variant=45046869819638 AG Adriano Goldschmied Wanderer Lightweight Stretch Shorts – Seattle Thread Company The AG Wanderer Short for men has a slim fit with a clean trouser look and a slightly tapered leg opening. This men’s short is designed in 7.4 oz. Brighton... ag adriano goldschmiedseattle thread companywandererlightweightstretch https://www.seattlethread.com/policies/shipping-policy Shipping policy – Seattle Thread Company seattle thread companyshipping policy https://www.seattlethread.com/collections/sale/products/brax-evans-tripe-stone-cotton-chino-pants?variant=47318103589110 BRAX Evans Triple Stone Stretch Cotton Chino Pants – Seattle Thread Company A midweight, sturdy, and soft cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate for work and everyday... seattle thread companystretch cottonchino pantsbraxevans https://www.seattlethread.com/products/claebradleymidcocoaleathersneakers CLAE Bradley Mid Cocoa Oiled Leather Sneakers – Seattle Thread Company A classic mid-top sneaker refined onto a premium, minimalistic silhouette, the Bradley Mid created by CLAE is as simple as it is functional. Crafted with fine... seattle thread companyleather sneakersclaebradleymid https://www.seattlethread.com/products/alberto-pipe-1942-regular-fit-dual-tone-ceramica-5-pocket-pants Alberto Pipe 1942 Regular Fit Dual Tone Ceramica 5 Pocket Pants – Seattle Thread Company These are Alberto Pipe Ceramica 5 Pocket pants featuring a soft and comfortable dual-tone weave fabric. Alberto Pipe Regular Fit Ceramica Temperature... seattle thread companyregular fitdual tonealbertopipe https://www.seattlethread.com/products/alberto-pipe-1577-regular-fit-light-tencel-stretch-jeans?variant=44811948392694 Alberto Pipe 1577 Regular Fit Lightweight Stretch Tencel Jeans – Seattle Thread Company Alberto Pipe Regular Fit jeans constructed using Alberto's best-selling Light Tencel Stretch Denim. This is a thin and lightweight tencel blend denim that is... seattle thread companyregular fitalbertopipelightweight https://www.seattlethread.com/collections/all Products – Seattle Thread Company seattle thread companyproducts https://www.seattlethread.com/products/ag-adriano-goldschmied-graduate-all-direction-stretch-denim-jeans AG Adriano Goldschmied Graduate All Direction Stretch Denim Jeans – Seattle Thread Company Premium stretch denim with advanced flexibility and modern construction. This off-duty essential offsets a relaxed waist with a tailored leg in a midnight-blue... ag adriano goldschmiedseattle thread companystretch denimgraduatedirection https://www.seattlethread.com/collections/lounge Lounge – Seattle Thread Company Kick back and relax with our outstanding collection of soft and comfortable casual threads! From underwear to joggers to tees and hoodies, we have you covered! seattle thread companylounge https://www.seattlethread.com/collections/jackets-outerwear Jackets & Outerwear – Seattle Thread Company seattle thread companyjacketsouterwear https://www.seattlethread.com/products/relwen-canvas-chore-coat?variant=47787294621942 Relwen Canvas Chore Coat – Seattle Thread Company New this season, this design is Relwen's take on the classic utility-driven chore coat design. Relwen has refined the usual design and has opted for something... seattle thread companychore coatrelwencanvas https://www.seattlethread.com/collections/geox Geox – Seattle Thread Company In 1995 Geox took Italy by storm, creating men's shoes that feature bold colors and contemporary designs while combining fashion and comfort. Today, Geox has... seattle thread companygeox https://www.seattlethread.com/products/albertopipe1572regularfitdynamicsuperfitstretchdenimjeans?variant=36308433633442 Alberto Pipe 1572 Regular Fit Dynamic Superfit Stretch Denim Jeans – Seattle Thread Company These clean-wash black denim jeans from Alberto are the perfect wardrobe staple! The soft stretch black denim fabric is flexible and comfortable for all-day... seattle thread companyregular fitstretch denimalbertopipe https://www.seattlethread.com/products/7-diamonds-bosworth-stretch-performance-shirt?variant=50109774856438 7 Diamonds Bosworth Stretch Performance Shirt – Seattle Thread Company A classic button-up crafted in Lido Stretch fabric featuring HD digital prints, custom 7D debossed taping, a hidden button-down collar, finished with a chest... seattle thread companyperformance shirtdiamondsbosworthstretch https://www.seattlethread.com/collections/sale/products/alberto-pipe-1837-premium-soft-flannel-ceramica-regular-fit-5-pocket-pants?variant=47212212289782 Alberto Pipe 1837 Premium Soft Flannel Ceramica Regular Fit 5-Pocket P – Seattle Thread Company A long standing brand, Alberto has been a family company since 1922. By creating styles utilizing generations of expertise, technological innovation, and high... seattle thread companyregular fitalbertopipepremium https://www.seattlethread.com/collections/rodd-gunn?filter.p.product_type=Shoes&filter.v.price.gte=&filter.v.price.lte=&filter.v.availability=1 Rodd & Gunn – Seattle Thread Company seattle thread companygunn https://www.seattlethread.com/collections/chelsea Chelsea – Seattle Thread Company seattle thread companychelsea https://www.seattlethread.com/products/bruun-stengade-saturn-wool-modal-blend-turtleneck-sweater Bruun & Stengade Saturn Wool Modal Blend Turtleneck Sweater – Seattle Thread Company seattle thread companyturtleneck sweatersaturnwoolmodal https://www.seattlethread.com/products/7-diamonds-solaro-stretch-performance-polo?variant=50109729439990 7 Diamonds Solaro Stretch Performance Polo – Seattle Thread Company Luxury minimalism was the angle taken for the Solaro Polo. Textured knit design, 7D Pearl buttons, side vents and sew-in collar stays. These elevated subtle... seattle thread companyperformance polodiamondssolarostretch https://www.seattlethread.com/collections/clae CLAE – Seattle Thread Company seattle thread companyclae https://www.seattlethread.com/products/clae-joshua-light-sneakers CLAE Joshua Light Sneakers – Seattle Thread Company 100% Vegan and crafted from 70% recycled materials, our signature trainers have been reimagined with sleek lines and subtle detailing. Recycled synthetic and... clae joshua light sneakersseattle thread company https://www.seattlethread.com/products/anchor-crew-orla-silver-and-nappa-leather-bracelet?variant=46982494290166 Anchor & Crew Orla Silver and Nappa Leather Bracelet – Seattle Thread Company The Orla Silver and Nappa Leather Bracelet was both designed and skilfully handcrafted completely in Great Britain. Combining British craft manufacturing with... seattle thread companynappa leatheranchorcreworla https://www.seattlethread.com/collections/sale/products/bruun-stengade-tusk-slim-fit-houndstooth-woven-pattern-dress-shirt?variant=44455838580982 Bruun & Stengade Tusk Slim Fit Woven Pattern Dress Shirt – Seattle Thread Company seattle thread companyslim fitdress shirt https://www.seattlethread.com/collections/gifts-accessories Gifts & Accessories – Seattle Thread Company seattle thread companygifts accessories https://www.seattlethread.com/products/alberto-pipe-1383-regular-fit-dynamic-superfit-colored-denim-jeans Alberto Pipe 1383 Regular Fit Dynamic Superfit Colored Denim Jeans – Seattle Thread Company These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly... seattle thread companyregular fitcolored denimalbertopipe https://www.seattlethread.com/products/blujackettannertrimfitnanotexwooldresspants BluJacket Tanner Trim Fit Nanotex Wool Dress Pants – Seattle Thread Company Exceptional fabrics, exceptional style. BluJacket uses a fabric blend of 97% wool and 3% cashmere to make this suit smooth and soft to the touch. Nanotex is a... seattle thread companydress pantstannertrimfit https://www.seattlethread.com/products/7-diamonds-renzo-stretch-performance-shirt?variant=50109726458102 7 Diamonds Renzo Stretch Performance Shirt – Seattle Thread Company A classic button-up crafted in Lido Stretch fabric featuring HD digital prints, custom 7D debossed taping, a hidden button-down collar, finished with a chest... seattle thread companyperformance shirtdiamondsrenzostretch https://www.seattlethread.com/collections/billy-reid Billy Reid – Seattle Thread Company Billy Reid grew up in Amite, Louisiana where his mother owned a women’s boutique in the hospitable environs of his grandmother’s former home. That early... seattle thread companybilly reid https://www.seattlethread.com/products/alberto-pipe-1489-regular-fit-super-stretch-colored-denim-jeans?variant=48890379927798 Alberto Pipe 1489 Regular Fit Super Stretch Colored Denim – Seattle Thread Company These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly... seattle thread companyregular fitsuper stretchcolored denimalberto https://www.seattlethread.com/collections/sale?filter.p.product_type=Knit+SS&filter.p.product_type=Shirt+SS&filter.p.product_type=T-Shirt&filter.v.availability=1 Sale Collection – Seattle Thread Company seattle thread companysale collection https://www.seattlethread.com/products/relwen-heavyweight-ringspun-pocket-tee Relwen Ringspun Pocket Tee – Seattle Thread Company A premium everyday T-shirt made from soft ring-spun cotton with a substantial midweight feel. Inspired by classic athletic tees from the 1960s and 70s, it... relwen ringspun pocket teeseattle thread company https://www.seattlethread.com/products/alberto-lou-j-1919-regular-fit-textured-cotton-chino-pants Alberto Lou-J 1919 Regular Fit Textured Cotton Chino Pants – Seattle Thread Company These Alberto Lou Regular Fit Chinos are made with a lightweight woven two-tone birdseye cotton fabric -- these chinos are comfortable and stylish. A wardrobe... seattle thread companyregular fitchino pantsalbertolou https://www.seattlethread.com/collections/sale/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts?variant=43051889230070 AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian... ag adriano goldschmiedseattle thread companygriffinlightweightstretch https://www.seattlethread.com/collections/renoir Pellagio & Renoir – Seattle Thread Company seattle thread companyrenoir https://www.seattlethread.com/collections/sale/products/billy-reid-pickwick-grid-plaid-soft-brushed-shirt?variant=49269232959734 Billy Reid Pickwick Grid Plaid Soft Brushed Shirt – Seattle Thread Company This classic shirt style features a spread collar with collar stays, our signature spade pocket with single-needle stitching, barrel cuffs, a French placket,... seattle thread companybilly reidbrushed shirtpickwickgrid https://www.seattlethread.com/pages/tailored-clothing Custom Tailored Clothing – Seattle Thread Company custom tailored clothingseattle thread company https://www.seattlethread.com/collections/alberto Alberto – Seattle Thread Company One of the top-selling brands of jeans and pants in Europe, Alberto is a highly regarded product for the discerning man. There is simply no comparison in terms... seattle thread companyalberto https://www.seattlethread.com/collections/bruun-stengade Bruun & Stengade – Seattle Thread Company seattle thread company https://www.seattlethread.com/collections/sale/products/agadrianogoldschmiedgriffinlightweightstretchsateenshorts?variant=43226904789238 AG Adriano Goldschmied Griffin Lightweight Stretch Sateen Shorts – Seattle Thread Company The Griffin Short features a relaxed upper block, slightly tapered leg opening, and clean trouser look. This short is designed with a lightweight, Italian... ag adriano goldschmiedseattle thread companygriffinlightweightstretch https://www.seattlethread.com/collections/cologne Grooming & Cologne – Seattle Thread Company seattle thread companygroomingcologne https://www.seattlethread.com/products/7-diamonds-everest-hybrid-shorts?variant=45226046226678 7 Diamonds Everest Hybrid Technical Shorts – Seattle Thread Company These 4-way stretch hybrid shorts are a cut above the rest. The signature 7Diamonds contrast tape detail and quick dry fabric, perform as well in water as it... seattle thread companytechnical shortsdiamondseveresthybrid https://www.seattlethread.com/collections/scarves Scarves – Seattle Thread Company seattle thread companyscarves https://www.seattlethread.com/collections/sale/products/billy-reid-linen-flat-front-trouser?variant=50345348399350 Billy Reid Linen Flat Front Trouser – Seattle Thread Company The Billy Reid Flat Front Trouser is refreshed in a luxe, lightweight linen for breathable comfort. This rendition has the same mid-rise and slim-fit... seattle thread companybilly reidflat frontlinentrouser https://www.seattlethread.com/collections/fulton-roark Fulton & Roark – Seattle Thread Company seattle thread companyfultonroark https://www.seattlethread.com/products/bruun-stengade-edvald-slim-fit-texture-woven-dress-shirt Bruun & Stengade Edvald Slim Fit Texture Woven Dress Shirt – Seattle Thread Company seattle thread companyslim fitdress shirt https://www.seattlethread.com/collections/sale/products/clae-joshua-sneakers?variant=46173077471478 CLAE Joshua Light Trainer Sneakers – Seattle Thread Company 100% Vegan and crafted from 70% recycled materials, our signature trainers have been reimagined with sleek lines and subtle detailing. Recycled synthetic and... seattle thread companyclaejoshualighttrainer https://www.seattlethread.com/products/ag-adriano-goldschmied-graduate-all-direction-stretch-denim-jeans?variant=6722712773 AG Adriano Goldschmied Graduate All Direction Stretch Denim Jeans – Seattle Thread Company Premium stretch denim with advanced flexibility and modern construction. This off-duty essential offsets a relaxed waist with a tailored leg in a midnight-blue... ag adriano goldschmiedseattle thread companystretch denimgraduatedirection https://www.seattlethread.com/collections/sale/products/borelio-napoli-overshirt?variant=46205807821046 Borelio Napoli Garment Dye Cotton Overshirt – Seattle Thread Company Borélio is a European workshop specializing in casual sartorial tailoring using the world's finest mills. They have been an EU industry leader for over 20... seattle thread companygarment dyenapolicottonovershirt https://www.seattlethread.com/collections/sale/products/brax-chuck-modern-fit-hi-flex-lightweight-5-pocket-pants?variant=46206543429878 BRAX Chuck Modern Fit Hi-Flex Lightweight 5 Pocket Pants – Seattle Thread Company A lightweight and soft sueded cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate with your next warm... seattle thread companybraxchuckmodernfit https://www.seattlethread.com/products/relwen-fineline-jersey-polo?variant=50549391360246 Relwen Fineline Jersey Polo – Seattle Thread Company Relwen’s take on the classic polo, the Fineline Jersey Polo, is crafted from a finespun jersey cotton that’s light and airy for long days in warm weather. Look... relwen fineline jersey poloseattle thread company https://www.seattlethread.com/collections/smith Smith – Seattle Thread Company seattle thread companysmith https://www.seattlethread.com/collections/7-diamonds 7 Diamonds – Seattle Thread Company seattle thread companydiamonds https://www.seattlethread.com/collections/marine-layer Marine Layer – Seattle Thread Company seattle thread companymarine layer https://www.seattlethread.com/collections/sale?filter.p.product_type=Sport+Coat&filter.p.product_type=Sport+Coat+Unstructured&filter.p.product_type=Suit&filter.v.availability=1 Sale Collection – Seattle Thread Company seattle thread companysale collection https://www.seattlethread.com/pages/shipping International Shipping – Seattle Thread Company All products ship from the US, and we are based in the US. International Shipping is available during checkout for the following destinations: - Canada -... seattle thread companyinternational shipping https://www.seattlethread.com/collections/shorts Shorts – Seattle Thread Company Flat front shorts and cargo shorts seattle thread companyshorts https://www.seattlethread.com/products/clae-malone-leather-court-sneakers CLAE Malone Leather Court Sneakers – Seattle Thread Company Handcrafted with fine leathers on CLAE's Premium Court sole (PC) Cushioned heel counter emphasizes support EVA insole for extra comfort seattle thread companyclaemaloneleathercourt https://www.seattlethread.com/collections/evolg Evolg – Seattle Thread Company seattle thread companyevolg https://www.seattlethread.com/products/alberto-pipe-1489-regular-fit-super-stretch-colored-denim-jeans Alberto Pipe 1489 Regular Fit Super Stretch Colored Denim – Seattle Thread Company These Pipe regular fit colored denim jeans from Alberto are the perfect alternative to blue jeans so you can create a fashionable look and stay perfectly... seattle thread companyregular fitsuper stretchcolored denimalberto https://www.seattlethread.com/products/alberto-pipe-1577-regular-fit-light-tencel-stretch-jeans?variant=48039330283766 Alberto Pipe 1577 Regular Fit Lightweight Stretch Tencel Jeans – Seattle Thread Company Alberto Pipe Regular Fit jeans constructed using Alberto's best-selling Light Tencel Stretch Denim. This is a thin and lightweight tencel blend denim that is... seattle thread companyregular fitalbertopipelightweight https://www.seattlethread.com/products/relwen-heavyweight-ringspun-pocket-tee?variant=50087075676406 Relwen Ringspun Pocket Tee – Seattle Thread Company A premium everyday T-shirt made from soft ring-spun cotton with a substantial midweight feel. Inspired by classic athletic tees from the 1960s and 70s, it... relwen ringspun pocket teeseattle thread company https://www.seattlethread.com/collections/sale/products/borelio-kenia-safari-jacket?variant=46205866017014 Borelio Kenia Garment Dye Cotton Safari Jacket – Seattle Thread Company Borélio is a European workshop specializing in casual sartorial tailoring using the world's finest mills. They have been an EU industry leader for over 20... seattle thread companygarment dyekeniacottonsafari https://www.seattlethread.com/products/alberto-pipe-1837-premium-soft-flannel-ceramica-regular-fit-5-pocket-pants Alberto Pipe 1837 Premium Soft Flannel Ceramica Regular Fit 5-Pocket P – Seattle Thread Company A long standing brand, Alberto has been a family company since 1922. By creating styles utilizing generations of expertise, technological innovation, and high... seattle thread companyregular fitalbertopipepremium https://www.seattlethread.com/collections/pikolinos Pikolinos – Seattle Thread Company seattle thread companypikolinos https://www.seattlethread.com/collections/bickley-mitchell Bickley + Mitchell – Seattle Thread Company Bickley + Mitchell specializes in knitwear products for men + women. They are an Amsterdam based fashion brand founded in 2011 by a small group of creatives in... seattle thread companybickleymitchell https://www.seattlethread.com/collections/hoodies Hoodies – Seattle Thread Company seattle thread companyhoodies https://www.seattlethread.com/cart Your Shopping Cart – Seattle Thread Company your shopping cartseattle thread company https://www.seattlethread.com/collections/sale?filter.p.product_type=Shirt+LS&filter.p.product_type=Shirt+Dress&filter.v.availability=1 Sale Collection – Seattle Thread Company seattle thread companysale collection https://www.seattlethread.com/collections/rails Rails – Seattle Thread Company seattle thread companyrails https://www.seattlethread.com/products/brax-evans-tripe-stone-cotton-chino-pants BRAX Evans Triple Stone Stretch Cotton Chino Pants – Seattle Thread Company A midweight, sturdy, and soft cotton 5 pocket pant by BRAX. Comfortable to wear with a bit of stretch. Simple solid colors to coordinate for work and everyday... seattle thread companystretch cottonchino pantsbraxevans https://www.seattlethread.com/collections/sale/products/brax-chuck-modern-fit-hi-flex-colored-denim-pants?variant=49105130094838 BRAX Chuck Modern Fit Hi-Flex Pants – Seattle Thread Company A sturdy midweight colored denim stretch fabric 5 pocket pant from BRAX. The fabric has a slight wash for tonal effects and dimension. These run very true to... seattle thread companybraxchuckmodernfit https://www.seattlethread.com/products/relwen-flyweight-flex-blazer?variant=50083051176182 Relwen Flyweight Flex Blazer – Seattle Thread Company A relaxed take on the traditional blazer, designed with the durability and comfort of a field jacket. This versatile piece can be worn casually or dressed up,... relwen flyweight flex blazerseattle thread company https://www.seattlethread.com/collections/sale/products/ag-adriano-goldschmied-tellis-commuter-performance-sateen-pants?variant=44960892584182 AG Adriano Goldschmied Tellis Airluxe Commuter Performance Sateen Pant – Seattle Thread Company The Tellis is a modern slim fit updated in our new 10 oz. Commuter Performance Sateen with premium stretch for enhanced mobility. Featuring a fitted upper... ag adriano goldschmiedseattle thread companytellisairluxecommuter https://www.seattlethread.com/products/ag-adriano-goldschmied-everett-slim-straight-all-direction-stretch-jeans AG Adriano Goldschmied Everett Slim Straight All Direction Stretch Jea – Seattle Thread Company Everett is a slim straight jean for men, offered in a dark wash stretch denim. The Everett has a comfortable mid-rise waist and a straight fit that’s relaxed... ag adriano goldschmiedseattle thread companyslim straighteverettdirection https://www.seattlethread.com/pages/returns Returns – Seattle Thread Company seattle thread companyreturns https://www.seattlethread.com/products/7-diamonds-rafael-stretch-performance-shirt 7 Diamonds Rafael Stretch Performance Shirt – Seattle Thread Company A standout shirt that’s easy to wear anywhere. The special textured fabric has a subtle, puckered look that gives it depth and style. Built with a hidden... seattle thread companyperformance shirtdiamondsrafaelstretch https://www.seattlethread.com/products/relwen-flyweight-flannel-woven-shirt Relwen Flyweight Flannel Woven Shirt – Seattle Thread Company Yarn-dyed lightweight flannel, a fresh twist on fall but without the weight. With its light weight, this is the ultimate soft and comfortable fall-weather... seattle thread companyrelwenflyweightflannelwoven https://www.seattlethread.com/products/bailey-1922-balans-roll-up-travel-hat Bailey 1922 Balans Packable Fedora Hat – Seattle Thread Company The Balans Roll Up is made for the traveler. Crafted from a very soft, lightweight braid, the Optimo crown allows it to be rolled and packed for any adventure... seattle thread companyfedora hatbaileybalanspackable https://www.seattlethread.com/products/barbour-nelson-linen-cotton-blend-ls-shirt Barbour Nelson Linen Cotton Blend LS Shirt – Seattle Thread Company Soft linen/cotton blend long sleeved tailored shirt in casual styling. 55% Linen, 45% CottonSingle 21's, Plain Weave, Enzyme Finish.Extra soft handle... seattle thread companylinen cottonbarbournelsonblend https://www.seattlethread.com/collections/shoes Shoes – Seattle Thread Company seattle thread companyshoes https://www.seattlethread.com/collections/knits-polos Polos & Knits – Seattle Thread Company seattle thread companypolosknits https://www.seattlethread.com/pages/stock-service-tailored-clothing Stock Tailored Clothing – Seattle Thread Company stock tailored clothingseattle thread company https://www.seattlethread.com/pages/contact-us Contact Us – Seattle Thread Company Retail Location Address: 9 Lake Street, Kirkland, WA 98033 10am - 7pm, Monday - Sunday (425) 202 7732 Have a question? Send us a message with this form, or... seattle thread companycontact us https://www.seattlethread.com/pages/about-us About Seattle Thread Company seattle thread company https://www.seattlethread.com/collections/anchor-crew Anchor & Crew – Seattle Thread Company seattle thread companyanchorcrew https://www.seattlethread.com/products/alberto-lou-j-1822-regular-fit-textured-cotton-blend-chino-pants?variant=47212217893110 Alberto Lou-J 1822 Regular Fit Textured Cotton Blend Chino Pants – Seattle Thread Company These Alberto Lou Regular Fit Chinos are made with an exceptionally soft midweight woven two-tone fabric for a textured wool look -- these chinos are... seattle thread companyregular fitcotton blendchino pantsalberto https://www.seattlethread.com/products/anchor-crew-padstow-bracelet Anchor & Crew Padstow Bracelet – Seattle Thread Company The Padstow Silver and Rope Bracelet was both designed and skillfully handcrafted completely in Great Britain. Combining British craft manufacturing with a... seattle thread companyanchorcrewpadstowbracelet https://www.seattlethread.com/collections/coal Coal – Seattle Thread Company Coal was founded on the belief that headwear is more than an accessory. It’s part of you, your identity, and your lifestyle. We build this idea into each of... seattle thread companycoal https://www.seattlethread.com/collections/bellroy Bellroy – Seattle Thread Company Started in 2010, the Bellroy design team wanted to construct a better, thinner wallet. With it's compact construction and high quality leather, Bellroy Wallets... seattle thread companybellroy https://www.seattlethread.com/collections/sale/products/alberto-stone-1393-modern-fit-t400-denim-jeans?variant=1299541688 Alberto Stone 1393 Modern Fit T400 Stretch Denim Jeans – Seattle Thread Company This is the Alberto year-round clean wash T400 Stretch Denim Jeans in the Modern Fit with a straight leg. We have been stocking this style for 11 years and... seattle thread companystretch denimalbertostonemodern https://www.seattlethread.com/products/ag-adriano-goldschmied-everett-slim-straight-cloud-soft-jeans?variant=44302925234422 AG Adriano Goldschmied Everett Slim Straight Cloud Soft Jeans – Seattle Thread Company Everett is a slim straight jean for men, offered in a mid wash denim. The Everett has a comfortable mid-rise waist and a straight fit that’s relaxed from hip... ag adriano goldschmiedseattle thread companyslim straightcloud softeverett https://www.seattlethread.com/collections/stance Stance – Seattle Thread Company Since 2009, Stance turned what was once an overlooked accessory into a fashion piece that encourages self-expression and creative originality that draws... seattle thread companystance https://www.seattlethread.com/collections/sale/products/bugatti-full-zip-track-jacket?variant=49039110537462 Bugatti Full Zip Track Jacket – Seattle Thread Company A dual-tone woven track jacket from the Bugatti collection. 75% Cotton / 25% Polyester bugatti full zip track jacketseattle thread company