Robuta

Sponsored by eBay second life | Shop on eBay Buy and sell on the world's online marketplace. Top brands, low prices, and free shipping on many items. https://iheartsl.com/ iheartsl – Second Life's Longest Running Blog Syndication Feed Second Life's Longest Running Blog Syndication Feed second liferunning blogiheartsllongestsyndication https://throughowlseye.com/ Second Life as a Living Cultural Space - Through Owl's Eye Jul 7, 2026 - Through Owl’s Eye explores art, music, and culture in Second Life — exhibitions, live performances, regions, and the people who shape this resident-built world. second lifeas acultural spaceliving https://status.secondlifegrid.net/ Second Life Status Welcome to Second Life's home for real-time and historical data on system performance. second lifestatus https://darkpassionsevents.wixsite.com/secondlife Dark Passions Events | Second Life Shopping Events dark passionssecond lifeeventsshopping https://danielvoyager.wordpress.com/ Daniel Voyager – Second Life, Linden Lab & OpenSim News daniel voyagersecond lifelinden labopensimnews https://secondlifeyachting.com/ Second Life Yachting second lifeyachting https://waymo.com/blog/2026/06/b2u-partnership/ A second life for EV batteries, clean energy for communities Today, we’re proud to announce our new EV battery repurposing program in partnership with B2U Storage Solutions. This strategic collaboration ensures that once... a second lifeev batteriesclean energycommunities https://ceakayballyhoo.wordpress.com/ ceakayballyhoo – A Second Life where imagination runs free A Second Life where imagination runs free a second lifeceakayballyhooimaginationrunsfree https://deuxlooks.com/ DeuxLooks – the independent second life fashion & beauty blog second life fashionthe independentdeuxlooksbeautyblog https://dictatorshop.store/ DICTATORSHOP - Second Life Furniture and Decor second lifedictatorshopfurnituredecor https://marketplace.secondlife.com/stores/25375 Second Life Marketplace - .Petrichor. by Vae Darkheart second lifemarketplacepetrichorvae https://marketplace.secondlife.com/stores/21322 Second Life Marketplace - BAKEMONOYA by Conjoh Kohime second lifemarketplace https://maps.secondlife.com/secondlife/Nooribeom/163/145/21 Second Life Maps | Nooribeom second lifemaps https://wiki.secondlife.com/wiki/Environmental_Enhancement_Project Environmental Enhancement Project - Second Life Wiki second lifeenvironmentalenhancementprojectwiki https://secondlifesyndicate.com/ Second Life Syndicate - News from the SL grid Providing up to date information about the Second Life metaverse. SL residents bring you the newest events, sales, games, art, help, communities, and much more! second life syndicatenews fromslgrid https://secondlife-status.statuspage.io/ Second Life Status Welcome to Second Life's home for real-time and historical data on system performance. second lifestatus https://radegast.life/ Radegast – A lightweight Second Life and OpenMetaverse viewer second liferadegastlightweightviewer https://marketplace.secondlife.com/stores/235 Second Life Marketplace - KDC: Kyrah Design Concept by Kyrah Abattoir second lifedesign conceptmarketplacekdckyrah https://wiki.secondlife.com/wiki/LSL_Portal LSL Portal - Second Life Wiki second lifelslportalwiki https://slauctions.com/ SL Auction Houses — Weekly Second Life Auction Schedule Browse weekly auction schedules for Second Life auction houses. Breedables, Events, and more — live calendar with real-time updates and instant cancellations. auction housessecond lifeslweeklyschedule https://marketplace.secondlife.com/stores/33574 Second Life Marketplace - DFS - Digital Farm System by Ice12192 Dover second lifedigital farmmarketplacedfssystem https://marketplace.secondlife.com/stores/255034 Second Life Marketplace - LVRS by Anika Whiskers second lifemarketplacelvrsanikawhiskers https://marketplace.secondlife.com/stores/89480 Second Life Marketplace - Azdesign by Azabel Kanya second lifemarketplacekanya https://marketplace.secondlife.com/stores/52318 Second Life Marketplace - MZD Tip Jars & Tech by Marcus Zenoria second lifetip jarsby marcusmarketplacemzd https://maps.secondlife.com/secondlife/Tres%20Chic/155/136/133 Second Life Maps | Tres Chic second lifemapstreschic https://www.dutchie.design/ Dutchie - Premium Second Life Furniture and 3D Homes May 20, 2026 - Discover Dutchie's high-quality Second Life Furniture and Homes. Transform your virtual world with our stylish Dutch 3D designs and the best Second Life sex... second lifedutchiepremiumfurniturehomes https://slnewser.blogspot.com/2022/04/sl19b-update-exhibitor-and-volunteer.html Second Life Newser: SL19B Update: Exhibitor and Volunteer Applications Now Open Yesterday, Thursday March 31, Linden Lab announced it would began accepting applications from those wishing to be among the exhibitors and... second lifevolunteer applicationsnewserupdate https://slnewser.blogspot.com/2013/01/ Second Life Newser: January 2013 Your source of news about the people, places, things, and events across Second Life. second lifenewserjanuary https://slnewser.blogspot.com/2016/03/reader-submitted-scenes-from-sunbeamer.html Second Life Newser: Reader Submitted: Scenes From the Sunbeamer Kickoff Jihan Wonder and Pagan Sunburn sent over some pictures they took of last week's Relay for Life Team Sunbeamer's Kickoff event . Here, P... second lifereader submittedfrom thenewserscenes https://slnewser.blogspot.com/2012/03/vwbpe-dragon-parade.html Second Life Newser: VWBPE Dragon Parade Thursday March 15th was the start of the 5th Annual VWBPE (Virtual Worlds Best Practices in education) Conference in Second Life. Three day... second lifenewservwbpedragonparade https://cheyennepal.blogspot.com/2011/11/through-looking-glass.html Chey's Second Life Blog: Through the Looking Glass "Alice, My Dear, You'll Never Become Queen If You Insist on Turning Your Back on Your Subjects" Written 14 November, 2011 Through the ... second lifecheybloglookingglass https://slnewser.blogspot.com/2013/07/press-release-burn2-town-hall-july-13.html Second Life Newser: Press Release: Burn2 Town Hall July 13 BURN2 invites you to a Town Hall on July 13, 2013, at 9 a.m. SLT and again at 6 p.m. SLT on the virtual playa (http://tinyurl.com/2013BUR... second lifepress releasetown hallnewserjuly https://slnewser.blogspot.com/2018/12/man-of-year-runner-up-draxtor-despress.html Second Life Newser: Man of the Year Runner-Up: Draxtor Despress Much like the Newser's Persons of the Year, the Second Life Birthday Group Volunteers , the runner-up is known for his accomplishments i... man of the yearsecond liferunner upnewser https://slnewser.blogspot.com/2011/08/united-for-change.html Second Life Newser: United for Change This weekend, there's a charity event aimed at helping children in Africa. A number of musicians and others are donating their time and ta... second lifenewserunitedchange https://groups.diigo.com/group/education-in-second-life/content/tag/peek360 Group items tagged peek360 - Education in Second Life | Diigo Groups This is a group for people who teach using SL (MG and TG) in second lifegroupitemstaggededucation https://slnewser.blogspot.com/2013/12/the-bay-city-tree-lighting.html Second Life Newser: The Bay City Tree Lighting On Sunday December 8, the Bay City area, a multisim region made to represent the classical North American urban experience, held it's ann... second lifethe baycity treenewserlighting https://slnewser.blogspot.com/2016/12/sunweaver-estates-get-private-estate.html Second Life Newser: Sunweaver Estates Get Private Estate Prim Increase On Tuesday November 29, Linden Lab announced it was starting the increases of the prim capacities of private sims . On Friday December 2,... second lifeget privatenewserestatesprim https://secondslog.blogspot.com/2008/01/second-life-statistics-16-jan-2008.html SLOG: Second Life Statistics: 16-Jan-2008 Wednesdays currency peak was the highest for a Wednesday. second lifeslogstatisticsjan https://learningcircuits.blogspot.com/2008/05/second-life-training.html Second Life Training This month's question came from a reader the June 2008 Big Question is: Second Life Training? More specifically: In what situations, do you ... second lifetraining https://slnewser.blogspot.com/2018/06/os-grid-hypergrid-business-winding-down.html Second Life Newser: OS Grid Hypergrid Business "Winding Down" After Nine Years For fans of Opensim, some sad news. HyperGrid Business, the leading source of news and other articles about the OS grids has been scaling... second lifehypergrid business https://slnewser.blogspot.com/2011/10/happy-anniversary-qwark-gemma.html Second Life Newser: Happy Anniversary Qwark & Gemma Yesterday, October 30th, was the 4rth anniversary of when SL Newser's Gemma Cleanslate and DJ Qwark Allen tied the knot. Solarhydro Cleansla... second lifehappy anniversarynewsergemma https://slnewser.blogspot.com/2021/07/second-life-birthday-sims-closed.html Second Life Newser: Second Life Birthday Sims Closed Since Thursday June 17, the sims of the Second Life 18th Birthday were open to the public. That is, until sometime in the morning of Frida... second lifenewserbirthdaysimsclosed https://antifascist-calling.blogspot.com/2008/07/total-information-awareness-finds-its.html Antifascist Calling...: Total Information Awareness Finds its "Second Life" at IARPA Like countless resurrections of Freddy Krueger , it appears that John Poindexter's Total Information Awareness (TIA) program has found a new... total information awarenesssecond lifeantifascistcalling https://slnewser.blogspot.com/2018/07/cartoon-of-day_25.html Second Life Newser: Cartoon of the Day From this year's Relay Track. Looks like DJ Madonna's trademark rubber suit has gotten some unexpected attention. By Bixyl Shuftan second lifeof thenewsercartoonday https://dettike-slfashion.blogspot.com/2011/04/artemis-group-gift.html Our Fashion Of Second Life: Artemis Group Gift our fashionsecond lifeartemisgroupgift https://slnewser.blogspot.com/2017/01/celebrating-three-million-dollar.html Second Life Newser: Celebrating The Three Million Dollar Milestone On Sunday January 15 at 1PM SL time, various members of the Relay for Life in Second Life met at the Relay d Alliez sim. They were celeb... second lifethe threemillion dollarnewsercelebrating https://oceans-and-fisheries.ec.europa.eu/news/northern-light-composites-giving-boats-second-life-2026-03-16_en?prefLang=nl Northern Light Composites: giving boats a second life - Oceans and fisheries Northern Light Composites (nlcomp), an Italian startup founded in 2019, is tackling one of the biggest challenges linked to composite materials: the... a second lifenorthern lightcompositesgivingboats https://slnewser.blogspot.com/2018/03/cureis-floating-gallery.html Second Life Newser: Curei's Floating Gallery Second Life has many art exhibitions. But how many are on a floating island? Deaflegacy found out about one named Curei's Floating Galler... second lifenewserfloatinggallery https://slnewser.blogspot.com/2021/07/announcement-vote-for-2022-relay-season.html Second Life Newser: Announcement: Vote For The 2022 Relay Season Theme It is time to vote for our 2022 Relay For Life Theme! We asked for suggestions the last 2 years and this year we are using some of the one... second lifefor thenewserannouncementvote https://dettike-slfashion.blogspot.com/2016/07/685.html Our Fashion Of Second Life: *685* our fashionsecond life https://slnewser.blogspot.com/2014/02/sl-video-gretchen-and-teddy.html Second Life Newser: SL Video: "Gretchen and Teddy" ( Click here if the video fails to load ) From Bryn Oh, "The story of Gretchen and Teddy." Uploaded Oct 2011. second lifenewserslvideogretchen https://slnewser.blogspot.com/2014/07/sl-video-three-shades-of-black.html Second Life Newser: SL Video: "Three Shades of Black" ( Click here to see the video ) Nydia Tungsten in another of her videos, " I got a wild hair and decided to do another Video to '3 Sh... second lifenewserslvideothree https://www.naughtymachinima.com/videos/second-life-sex?q=all&o=bw Second Life Sex 3D Animated Porn Videos - Being Watched - Naughty Machinima Second Life Sex 3D Animated Porn Videos - Being Watched - Videos - Adult animated 3d porn videos, and rule 34 video from Skyrim, Mass Effect, Second Life, The... second life sexanimated pornbeing watched https://bunnyisles.blogspot.com/2022/05/ IKSDP Harambee Gwassi Kenya Project in Second Life: maggio 2022 Blog del gruppo "Bunny Isles for Kenya" di Second Life, dedicato alla raccolta fondi per le scuole "IKSDP-Harambee Project Gwassi Kenya": annunci, cronache... in second lifekenya projectharambeemaggio https://slnewser.blogspot.com/2011/10/stoker-serpentine-releases-sexgen-bed.html Second Life Newser: Stoker Serpentine Releases SexGen Bed as Freebie Stroker Serpentine, has reportedly released his noted SexGen bed to be freely available to Second Life residents. According to the Herald , ... second lifenewserstokerserpentinereleases https://slnewser.blogspot.com/2021/11/eotb-applications-being-accepted-for.html Second Life Newser: EOTB: Applications Being Accepted For Christmas "Shop and Hop" * It's not quite Christmas time yet. Halloween was just a few days ago and Thanksgiving is a few weeks away. But some are already getting r... second life https://librarian.blogs.princeton.edu/2007/10/second_life_pac_man_and_comput/ Second Life, Pac Man, and Computer Chess | Academic Librarian Sep 27, 2015 - Recently, I was asked my professional opinion about Second Life, and this is one answer. When I give periodic talks about Google, I demo Google Gadgets and... second lifepac mancomputer chessacademiclibrarian https://slnewser.blogspot.com/2019/06/ Second Life Newser: June 2019 Your source of news about the people, places, things, and events across Second Life. second lifenewserjune https://www.denial-design.com/ Denial Design | Enjoy Your Second Life Here second lifedenialdesignenjoy https://slnewser.blogspot.com/2019/04/seeing-double.html Second Life Newser: Seeing Double? Taken at the Virtual Ability conference yesterday. Nope, this isn't some fancy computer editing. Erik Mondrian is one of the handful of ... second lifenewserseeingdouble https://secondlife-fashion.blogspot.com/ Second Life - Fashion second lifefashion https://usa.chinadaily.com.cn/china/2014-12/10/content_19057537.htm Nun gives second life to abandoned children[1]| Society Sports channel covers stories and pictures of soccer, basketball, tennis, motor racing, stars and Beijing Olympics. Chinadaily.com.cn is the largest English... second lifeabandoned childrennungivessociety https://slnewser.blogspot.com/2016/12/a-cry-for-help-from-venezuela.html Second Life Newser: A Cry For Help From Venezuela A year ago, the Newser interviewed Alejandra Jumanya, also known inworld as Miss W. A skilled content creator with a line of women's fash... cry for helpsecond lifenewservenezuela https://slnewser.blogspot.com/2020/05/group-notices-date-and-time-glitch.html Second Life Newser: Group Notices Date And Time Glitch If there's something funny with your group notices, you're not alone. After a friend messaged me saying she couldn't find a post made the... date and timesecond lifenewsergroupnotices https://snufflesbreedables.net/ Snuffles Breedable Pets - Second Life Breedables Featuring Crypto Baby Poo Snuffles Breedables - Second Life strategic market-powered breedable game featuring Baby Poo Crypto on the Solana blockchain. Breed, trade, and learn about... second lifesnufflesbreedablepetsfeaturing https://slnewser.blogspot.com/2014/04/sl-video-educating-with-mad-lab.html Second Life Newser: SL Video: Educating With MAD Lab ( Click here if the video is blocked ) Prom Pookymedia: "Merced County in California needed to upgrade and modernize their Vector Cont... second lifenewserslvideoeducating https://ltu.diva-portal.org/smash/record.jsf?pid=diva2:1006727 Selling green dots in second life : teaching note in second lifegreen dotssellingteachingnote https://slnewser.blogspot.com/2013/07/breezes-thoughts-twas-old-lady-part-2.html Second Life Newser: Breezes Thoughts: "Twas an Old Lady ..." Part 2 Breezes Babii is back with the next part of her story about a lady who ventures from home to find more than she bargained for. Read the n... second lifeold ladynewserbreezesthoughts https://slnewser.blogspot.com/2015/06/1920s-chicago-roleplay.html Second Life Newser: 1920's Chicago Roleplay Fritter Enzyme is back from exploring an American city from an earlier time. In the 1920's Chicago roleplay area, visitors are welcome to... second lifenewserchicagoroleplay https://tracyserra.blogspot.com/ Tracy's Second Life Blog tracy ssecond lifeblog https://slnewser.blogspot.com/2019/10/ Second Life Newser: October 2019 Your source of news about the people, places, things, and events across Second Life. second lifenewseroctober https://slnewser.blogspot.com/2013/07/wounded-warrior-bennefit-raises-over.html Second Life Newser: Wounded Warrior Bennefit Raises over 90,000 Lindens On Sunday evening, July 28, Veterans Isle had their monthly Wounded Warrior Bennefit. The live music event was organized in part by Frets... second lifewounded warriornewser https://slnewser.blogspot.com/2021/11/sl-video-turkey-race.html Second Life Newser: SL Video: "Turkey Race!" ( Click here if the video does not play ) From Juala D on November 20, a group of turkeys racing down a forest trail to "Benny Hill" music... second lifenewserslvideoturkey https://slnewser.blogspot.com/2018/09/team-firestorms-eighth-anniversary-party.html Second Life Newser: Team Firestorm's Eighth Anniversary Party Today, Sunday September 23, is when Team Firestorm, the people behind the most popular Second Life viewer, celebrates their eighth anniv... second lifenewserteamfirestormeighth https://slnewser.blogspot.com/2013/05/rfl-fantasy-faire-2013-breaks-record.html Second Life Newser: RFL Fantasy Faire 2013 Breaks Record This year's Relay For Life Fantasy Faire was the best ever in Second Life. As of May 2, over 9,000,000 Lindens were raised to help the Amer... second lifefantasy fairenewserrflbreaks https://slnewser.blogspot.com/2018/06/your-mother-has-cancer.html Second Life Newser: "Your Mother Has Cancer" Deaflegacy told be recently it was her mother's birthday. It was a happy occasion in the past, but today it was a sad reminder as she had... second lifeyour mothernewsercancer https://slnewser.blogspot.com/2013/01/nats-jazz-club.html Second Life Newser: Nat's Jazz Club Gemma Cleanslate came across a place in Second Life that has both a gallery and a social club. In the P aradise Vall ey sim , one can adm... second lifenewsernatjazzclub https://slnewser.blogspot.com/2015/03/facebook-insists-no-games-character.html Second Life Newser: Facebook Insists No "Games Character" Names Earlier this month came two developments from social media that were less than welcome news to Second Life users. For residents who use Fac... second lifeno gamesnewserfacebookinsists https://slnewser.blogspot.com/2015/05/sl-video-dont-don-sl-dance.html Second Life Newser: SL Video: "Don't Don SL Dance" ( Click here if the video fails to play ) By M2MaFang on Oct 2011 second lifedon tnewserslvideo https://slnewser.blogspot.com/2013/11/cyclops-contest-continues.html Second Life Newser: Cyclops Contest Continues The contest we started last week , inspired by Becky Shamen, for a cyclops avatar an the attractive side, is still going on. Here, Becky... second lifenewsercyclopscontestcontinues https://slnewser.blogspot.com/2011/11/cartoon-of-day_20.html Second Life Newser: Cartoon of the Day second lifeof thenewsercartoonday https://slnewser.blogspot.com/2020/12/some-christmas-events-in-second-life.html Second Life Newser: Some Christmas Events in Second Life Christmas is a time in Second Life with a lot happening. In the days before and the day after, there were plenty of events going on. Variou... second lifechristmas eventsnewser https://slnewser.blogspot.com/2016/06/interview-with-pilot-of-airwaves-otawan.html Second Life Newser: Interview with Pilot of the Airwaves (Otawan Fouquet) You might have seen her at a few Relay for Life events by Team Ministry of Dance, or perhaps places such as the Taj Mahal or Safra Nitely... second lifeinterview withof thenewser https://slnewser.blogspot.com/2017/09/sl-video-jex.html Second Life Newser: SL Video: "Jex" ( Click here if the video fails to play ) By Furry Andy on July 18 second lifenewserslvideojex https://slnewser.blogspot.com/2023/11/do-you-have-story_0723648909.html Second Life Newser: Do YOU Have A Story? On occasion, Second Life Newser will print an article or picture submitted to us by one of you, the readers. Have you seen a particul... do you havesecond lifenewserstory https://bunnyisles.blogspot.com/2020/12/ IKSDP Harambee Gwassi Kenya Project in Second Life: dicembre 2020 Blog del gruppo "Bunny Isles for Kenya" di Second Life, dedicato alla raccolta fondi per le scuole "IKSDP-Harambee Project Gwassi Kenya": annunci, cronache... in second lifekenya projectharambeedicembre https://digicmb.blogspot.com/2006/12/epn-report-second-life-of-virtual.html?showComment=1165536360000 EPn-report "The Second Life of Virtual reality" Finally the English version of the EPN-report on Second Life is available. You can ask for the pdf by sending an email to: info@epn.net Th... the second lifeepnreportvirtualreality https://www.engadget.com/2007-11-07-new-second-life-viewer-release-1-18-4.html New Second Life viewer release: 1.18.4 Nov 8, 2007 - The cycle of release candidates and bug-fixes has largely come to a close, with only a single bug-fix listed between the last release candidate and the new... second lifenewviewerrelease https://www.engadget.com/2010-03-23-linden-lab-axes-vivox-slim-second-life-client-beta.html Linden Lab axes Vivox SLim Second Life client beta Mar 23, 2010 - Back in 2008, quite a big thing was made of Vivox's lightweight voice/IM client for Second Life, called SLim. That buzz continued through 2009, with the... linden labsecond lifeaxesvivoxslim https://slnewser.blogspot.com/2019/12/second-life-blogger-daniel-voyager-on.html Second Life Newser: Second Life Blogger Daniel Voyager on Hiatus One noted blogger about Second Life, Daniel Voyager, will be taking a short break. A few days ago, he announced due to real life events... second lifedaniel voyagernewserbloggerhiatus https://libetiquette.blogspot.com/2007/02/second-life-joining.html?showComment=1171083780000 A Librarian's Guide to Etiquette: Second Life, Joining Librarians should think twice before joining Second Life in an attempt to connect with patrons. Your patrons don't want to be friends with... a librarianguide tosecond lifeetiquettejoining https://stunlaw.blogspot.com/2007/06/second-life-and-conference.html Second Life and Conference Participation... Understanding digital media, technology, theory, culture and society. second lifeconferenceparticipation https://slnewser.blogspot.com/2023/11/places-from-2006-that-are-still-around.html Second Life Newser: Places From 2006 That Are Still Around We recently were contacted by a Wol (Wolwaner Jervil), of the SL Guided Tours Team. He send a small article of several places that were ar... second lifenewserplacesstillaround https://slnewser.blogspot.com/2012/08/international-disability-rights.html Second Life Newser: International Disability Rights Affirmation Conference at Virtual Ability on Gentle Heron called me to say that this weekend, Friday and Saturday, August 3 and 4, there will be a Conference at the Sojourner Auditoriu... second lifedisability rights https://slnewser.blogspot.com/2022/10/sl-video-second-lifes-lab-gab-halloween.html Second Life Newser: SL Video: "Second Life's Lab Gab - Halloween 2022" ( Click here if the video does not play ) From Second Life's Youtube channel, a recording from the Thursday October 27 Lab Gab, " Stra... second lifenewserslvideolab https://slnewser.blogspot.com/2016/04/cheesy-tournament-at-happy-vixen-more.html Second Life Newser: "Cheesy" Tournament at the Happy Vixen: More Pictures Well, sometimes when you think you've lost something, you've found it again. When I was looking for pictures of last weekend's "Cheesy" ... second lifeat thenewsercheesytournament https://tarasviewonbooks.blogspot.com/2008/08/making-of-second-life-giveaway.html Tara's View on Books: The Making of Second Life GIVEAWAY!! Social Media Manager, Virtual Assistant, Canadian, pastor's wife, and work at home mom of 3 blogs, posts product reviews and hosts giveaways. the making ofview onsecond lifetarabooks https://slnewser.blogspot.com/2019/08/announcement-this-week-at-seanchai.html Second Life Newser: Announcement: This Week at the Seanchai Libraries SOMETHING SMELLS LIKE A STORY! Maybe it's the fish in Bertie Wooster's bedroom, something wafting through the icy reaches of outer space, o... second lifethis weekat thenewserannouncement https://dettike-slfashion.blogspot.com/2011/08/jesylilo-ocio-xtreme-hunt.html Our Fashion Of Second Life: JeSyLiLO ( Ocio Xtreme Hunt ) our fashionsecond lifeocioxtremehunt https://slnewser.blogspot.com/2022/03/this-saturday-at-science-circle_0888029654.html Second Life Newser: This Saturday at The Science Circle Saturday, March 19 ~*~ At 10 AM PST On Expectation and Prediction of Events Robert A. Hendrix MD https://w... second lifethis saturdaythe sciencenewsercircle