https://www.meesho.com/waterproof-rectangle-purple-wallpaper-self-adhesive-wall-sticker-for-tv-wall-office-almirah-kitchen-area-drawing-room-and-any-other-flat-surface40x200cm-set-of-3/p/8gptgo
Name: Waterproof Rectangle Purple Wallpaper Self Adhesive Wall Sticker For TV Wall Office Almirah Kitchen Area Drawing Room And Any Other Flat Surface(40x200CM...
purple wallpaperself adhesivewaterproofrectanglesticker
https://www.meesho.com/hi-stickers-xl-200-cm-silver-grey-triangle-roll-of-9-sq-ft-self-adhesive-wallpaper/p/6yz199
Name: HI STICKERS XL 200 CM Silver grey triangle ROLL OF 9 SQ FT SELF ADHESIVE WALLPAPER Material: Vinyl Color: Multi Type: Living Room Theme: Home Product...
silver greytriangle rollhistickersxl
https://www.meesho.com/mr-printart-decorative-door-wallpaper-self-adhesive-door-wallpaper-30x78-door-vinyl-stickers-waterproof-for-wood-pattern-door-wallpaper-home-office-kitchen-living-room-bedroom/p/bgd5q1
Name: MR Printart Decorative Door Wallpaper | Self Adhesive Door Wallpaper 30x78 | Door Vinyl Stickers Waterproof for Wood Pattern Door Wallpaper | Home,...
self adhesivemrdecorativedoorwallpaper
https://www.meesho.com/2-sheet-3d-pe-foam-self-adhesive-brick-design-wall-stickersdiy-wallpaper-for-home-hotel-living-room-bedroom-cafe-decor-diy-wall-paper-70x77cm/p/3m0o1h
Name: 2 Sheet 3D PE Foam self Adhesive Brick Design Wall Stickers/DIY Wallpaper for Home Hotel Living Room Bedroom Cafe Decor DIY Wall Paper 70x77cm Material:...
pe foamself adhesivebrick designsheetwall
https://www.meesho.com/nareval-size-60200-cm-self-adhesive-wallpaper-wallpaper-for-kitchen-wall-oil-proof-furniture-wallpaper-waterproof/p/9ghmq8
Name: NAREVAL SIZE 60*200 CM SELF ADHESIVE WALLPAPER wallpaper for kitchen wall oil proof furniture wallpaper waterproof Material: Vinyl Type: Wall Stickers...
self adhesive wallpapersizecm
https://www.target.com/p/nuwallpaper-vintage-tin-tile-peel-38-stick-wallpaper-gray/-/A-76341658
Shop NuWallpaper Vintage Tin Tile Peel & Stick Wallpaper Gray: Antique Mosaic Design, Self-Adhesive, Washable Vinyl at Target. Choose from Same Day Delivery,...
nuwallpapervintagetintilepeel
https://www.lowes.com/pd/Tempaper-28-sq-ft-Pearl-Grey-Vinyl-Moire-Self-Adhesive-Peel-and-Stick-Wallpaper/1001311828
Shop Tempaper 28-sq ft Pearl Grey Vinyl Moire Self-adhesive Peel and Stick Wallpaper MD10581 in the Wallpaper department at Lowes.com
sq ftself adhesivepearlgreyvinyl
https://www.meesho.com/nareval-marble-self-adhesive-wallpaper-for-almirah-cupboard-floor-wall-fridgedoor-decorative-furniture-interior-size60200cm/p/6cfn6x
Name: NAREVAL Marble Self Adhesive Wallpaper for Almirah Cupboard, Floor, Wall, Fridge,Door Decorative Furniture Interior (SIZE:60*200CM) Material: Vinyl...
self adhesive wallpapermarblealmirahcupboardfloor
https://www.houzz.com/photos/hojas-cubanas-self-adhesive-wallpaper-st-louis-phvw-vp~119792873
Tempaper Peel and stick. Remove or reposition. That's the beauty of Tempaper Self-Adhesive Wallpaper. In attractive styles and colors - designed by celebrities
self adhesive wallpaperst louissoft surroundingshojascubanas
https://www.dunelm.com/product/black-stone-self-adhesive-backsplash-wallpaper-1000244417
* Stone-Inspired Design * Safe for Walls * Ideal for Renovating & Upcycling * Leaves No Residue * Waterproof, Fireproof & Heat Resistant Add a striking touch...
black stoneself adhesivebacksplashwallpaperdunelm
https://shopee.com.my/Self-adhesive-Custom-size-retro-world-map-for-background-wall-3d-wallpaper-cartoon-map-children's-bedroom-home-decor-cafe-bar-mural-sticker-i.114560617.1805115080
(1) The Mural is customized according to the size,please place the order refer the following caculation method: 1 unit=1m2 (1 square meter).The order...
self adhesivecustom sizeworld mapretrobackground
https://www.dhgate.com/product/wallpapers-wallpaper-self-adhesive-cement/1044507357.html
Selecting cheap wallpapers wallpaper self-adhesive cement wall rough room wallpaper dice ceiling decoration wallpaper ceiling s25213 on DHgate.com? Here, you...
self adhesivecement wallwallpapersroughroom
https://www.dunelm.com/product/nu-wall-self-adhesive-spot-mono-wallpaper-1000196642
* Geometric spot design * Self adhesive * Leaves no sticky residue Add a beautiful modern look into your home using the Nu Wall Spot Wallpaper that boasts a...
self adhesivenuwallspotmono
https://www.meesho.com/kashival-wall-stickers-wallpaper-diy-decal-3d-frames-pvc-diy-self-adhesive-kitchen-and-home-living-room-bedroom-size7070-cm-sheet-gold-dot-10-pcs/p/arl8mo
Name: KASHIVAL Wall Stickers Wallpaper DIY Decal 3D Frames PVC DIY Self Adhesive Kitchen and Home Living Room, Bedroom (SIZE:70*70 CM) SHEET GOLD DOT 10 PCS...
wall stickerswallpaperdiydecalframes