https://www.uab.edu/news/research-innovation/specific-trigeminal-sensory-nerve-cells-inhibition-presents-potential-treatment-pathway-for-craniofacial-pain-caused-by-mechanical-allodynia
Specific trigeminal sensory nerve cells inhibition presents potential treatment pathway for...
UAB researchers identify specific trigeminal sensory neurons driving mechanical allodynia, revealing how targeted inhibition of pain-signaling afferents and...
sensory nervetreatment pathwayspecifictrigeminalcells
https://neurotron.com/
Neurometer CPT Clinical and Laboratory Sensory Nerve Conduction Test by Neurotron, Incorporated -...
Neurometer CPT electrodiagnostic sensory nerve conduction threshold (sNCT) testing equipment
sensory nerve
https://www.cms.gov/medicare-coverage-database/view/ncd.aspx?ncdid=270&ncdver=2&=
NCD - Sensory Nerve Conduction Threshold Tests (sNCTs) (160.23)
Use this page to view details for NCD - Sensory Nerve Conduction Threshold Tests (sNCTs) (160.23).
sensory nervencdconductionthresholdtests
https://pmc.ncbi.nlm.nih.gov/articles/PMC7874308/
Airway Sensory Nerve Density Is Increased in Chronic Cough - PMC
Rationale: Chronic cough is characterized by frequent urges to cough and a heightened sensitivity to inhaled irritants. Airway sensory nerves trigger cough. We...
sensory nervechronic coughairwaydensityincreased
https://www.uab.cat/web/news-detail/where-do-motor-and-sensory-neurons-regenerate-after-severe-nerve-injury-1345680342044.html?noticiaid=1345879619591
Where do motor and sensory neurons regenerate after severe nerve injury? - Divulga UAB - University...
After a severe nerve injury that disrupts the axons, neurons can regenerate, reinnervate their target organ and, therefore, recover their function. of the...
https://www.elsevier.com/resources/anatomy/nervous-system/peripheral-nervous-system/sensory-root-of-facial-nerve-right/16664
Sensory Root of Facial Nerve (Right) | Complete Anatomy
Discover the origin, course, branches, and supply of the facial nerve, along with related clinical correlates.
sensory rootfacial nerverightcompleteanatomy
https://www.aapc.com/codes/icd-10-codes/S44.51XD
ICD-10 Code for Injury of cutaneous sensory nerve at shoulder and upper arm level, right arm,...
ICD-10 code S44.51XD for Injury of cutaneous sensory nerve at shoulder and upper arm level, right arm, subsequent encounter is a medical classificatio
https://www.wikidata.org/wiki/Q39336204
Specificity of retrograde transport of nerve growth factor (NGF) in sensory neurons: A biochemical...
scientific article published on May 16, 1975
nerve growth factor
https://pmc.ncbi.nlm.nih.gov/articles/PMC44230/
The p75 nerve growth factor receptor mediates survival or death depending on the stage of sensory...
The function of the low-affinity nerve growth factor (NGF) receptor, p75NGFR, in regulating neuronal survival during development is unclear. The sensory...
nerve growth factor receptor
https://www.wikidata.org/wiki/Q46270463
The effect of sensory nerve depletion on cholinergic neurotransmission in guinea pig airways -...
scientific article published on March 1, 1992
https://www.mdpi.com/2673-4087/4/4/25
The Effects of Zinc on Proprioceptive Sensory Function and Nerve Conduction
Zinc (Zn2+) is an essential element that can promote proper organ function, cell growth, and immune response; it can also, however, be present in too great a...
the effectszinc