https://www.cbsnews.com/sanfrancisco/news/mrs-claus-christmas-nonprofit-joy-san-jose-families/
South Bay "Mrs. Claus" brings Christmas joy and more to San Jose families - CBS San Francisco
Dec 12, 2024 - It's the most wonderful time of the year for a South Bay woman who has played Mrs. Claus for more than 40 years for the children of North San Jose's Alviso...
south baymrs clausand moresan josebrings
https://labodywork.com/
LA BODYWORK - THE BEST IN SOUTH BAY
Sep 26, 2025 - Southbay's Best Bodywork. We are movement specialists, setting the standard for manual therapy. We offer massage therapy, stretching, cupping, mobility and...
the bestsouth baylabodywork
https://sfbay.craigslist.org/sby/cls/d/cupertino-beauty-classes-hands-on/7926890607.html
south bay classes - craigslist
south bay classes - craigslist
south bayclassescraigslist
https://www.cbsnews.com/sanfrancisco/news/icon-award-unhoused-residents-homeless-united-effort-organization-santa-clara-county/
South Bay pair helping unhoused residents rebuild their lives - CBS San Francisco
Apr 22, 2026 - The number of unhoused people living in Santa Clara County has soared 63% in the last decade, according to county point-in-time counts. Now a pair of women is...
south baysan franciscopairhelpingresidents
https://www.mercurynews.com/2026/04/08/state-doles-out-50-million-more-for-homelessness-in-south-bay/
CA sends funds to South Bay for homelessness projects
Apr 9, 2026 - Newsom released funds for homelessness solutions Wednesday, as advocates and state lawmakers press him for more.
south baycafundshomelessnessprojects
https://patch.com/new-york/longisland/classifieds/gigs-services/578562/charter-a-sport-yacht-along-fire-island-in-the-great-south-bay
Charter a Sport yacht along Fire Island in the Great South Bay ! - Long Island, NY Patch
Charter a 41 foot Searay 390 with a USCG Captain and a Host. Two hour minimum for 6 people. Visit ports , restaurants or leisurely cruise and/or...
fire islandin thesouth baychartersport
https://www.mercurynews.com/2026/03/27/nob-hill-food-jobs-mountain-view-store-economy-work-retail-grocery/
Nob Hill Foods will shut a South Bay store and chop dozens of jobs
Mar 27, 2026 - Nob Hill Foods will shut a South Bay supermarket and slash scores of jobs by the end of May.
nob hillsouth bayfoodsshutstore
https://sfbay.craigslist.org/sby/rid/d/party-bus-ia-goving-rides/7929819328.html
south bay rideshare - craigslist
south bay rideshare - craigslist
south bayridesharecraigslist
Sponsored https://www.blackedraw.com/
BLACKED RAW: Unfiltered Encounters with Powerful Men in 4K
https://www.meetup.com/south-bay-mahjong-sundays/events/314398182/
South Bay Mahjong Sundays, Sun, Apr 26, 2026, 1:00 PM | Meetup
Mahjong is a 4-person game of skill, strategy, and luck played with tiles on a game table. We host weekly mahjong parties, no entry fee required. Beginners...
apr 26 2026south baymahjongsundayspm
https://www.bizex.net/listing/712
South Bay Beer Bar in Hawthorne, CA - No Food Service - BizEx
Divey and chill neighborhood Beer Bar in the South Bay. Unbeatable rent at only $900/mo!! This spot is known for its best on-tap beer selection and...
south bayfood servicebeerbarhawthorne
https://www.latimes.com/california/story/2026-04-28/torrance-hometown-of-suspect-in-press-gala-shooting-oasis-for-la-county-gun-lovers
Cole Tomas Allen purchased weapons in L.A.'s South Bay, a hot spot for gun sales - Los Angeles Times
Apr 28, 2026 - Southwest L.A. County has a well-established reputation for being a relatively gun-friendly area within a more broadly pro-gun-control county and region.
cole tomas allenlos angeles timessouth bayhot spotpurchased
https://evajacobsre.com/
Eva Jacobs | Manhattan Beach and South Bay Real Estate Specialist
Eva Jacobs, your trusted real estate professional, specializes in residential luxury sales and excels in multifamily transactions. With a wealth of experience,...
manhattan beachsouth bayreal estateevajacobs
https://www.mercurynews.com/2026/04/20/pge-electric-economy-tech-power-build-property-energy-develop-jobs-ai/
South Bay electricity grid gets fresh boost with new transmission line
Apr 23, 2026 - A seven-mile electric transmission line is slated to be built underneath San Jose and Santa Clara, a project that is poised to further bolster efforts to...
south bayelectricity gridgetsfreshboost
https://sfbay.craigslist.org/sby/
craigslist: south bay jobs, apartments, for sale, services, community, and events
craigslist provides local classifieds and forums for jobs, housing, for sale, services, local community, and events
apartments for salecommunity and eventssouth baycraigslistjobs
https://www.meetup.com/write-the-docs-bay-area/events/314395053/
South Bay Tech Writers: Pre-WTD Happy Hour 🍻, Fri, Apr 24, 2026, 5:00 PM | Meetup
Before WTD Portland, there’s this. Join fellow technical writers for a relaxed evening of drinks, conversation, and community. Traveling to Portland? Start the...
apr 24 2026south bayhappy hourtechwriters
https://laescortmodels.com/model/south-bay-escorts
South Bay escorts | Escorts in South Bay, independent escort girls in South Bay escorts directory....
independent escort girlssouth bayescortsdirectory
https://www.meetup.com/southbay-buddhism-for-beginners/
South Bay Buddhism for Beginners Meetup | Meetup
Wishing you all a New Year full of lasting joyfulness and serenity. Thank you for all your support in various ways to help us continue delivering Dharma to a...
south bayfor beginnersbuddhismmeetup
https://www.southbayriders.com/forums/
South Bay Riders
An online community for motorcycle riders.
south bayriders
https://www.bizex.net/blog/new-business-for-sale-community--non-sterile-pharmacy---south-bay
New Business For Sale: Community & Non-Sterile Pharmacy - South Bay - BizEx
business for salesouth baynewcommunitynon
https://southbaycenter.wixsite.com/southbaylgbtcenter
Home | South Bay LGBTQ Center
Proudly serving the South Bay LGBTQ+/Queer community for over 30 years.
south baylgbtqcenter
https://www.cbsnews.com/sanfrancisco/local-news/south-bay/
Latest South Bay news and headlines - CBS San Francisco
Get the latest South Bay news and headlines from KPIX-TV CBS San Francisco.
south bay newssan franciscolatestheadlinescbs
https://www.kqed.org:443/news/12080399/south-bay-toddler-placed-with-woman-convicted-of-child-endangerment-before-death
South Bay Toddler Placed With Woman Convicted of Child Endangerment Before Death | KQED
Apr 20, 2026 - Jaxon Juarez died just weeks after being placed with Bridget Martinez.
south baychild endangermenttoddlerplacedwoman
https://www.meetup.com/south-bay-knit-crochet/events/313361573/
South Bay Knit & Crochet Weekend Crafting - Sundays, Sun, Apr 26, 2026, 3:00 PM | Meetup
Enjoy crafting and drinking a good cup of tea? Come to Starbucks located in Mercado center (on Mission college Blvd) on Sunday afternoon. Meetup with other...
apr 26 2026south bayknitcrochetweekend
https://sfbay.craigslist.org/sby/vnn/d/san-jose-big-garage-yard-sale/7928495735.html
south bay local news and views - craigslist
south bay local news and views - craigslist
news and viewssouth baylocalcraigslist
https://www.fireislandnews.com/
Fire Island News & Great South Bay News | Long Island
Mar 6, 2024 - Fire Island News is the island’s longest publishing newspaper, as well as the news publication of record, and your go-to for arts, culture, and theater.
fire islandsouth baynewsgreatlong
https://www.latimes.com/food/story/2023-05-03/sakae-sushi-gardena-futomaki-south-bay
This South Bay sushi restaurant specializes in homestyle futomaki and oshizushi - Los Angeles Times
May 6, 2023 - Sakae Sushi has been making simple, homestyle sushi in Gardena since the 1960s. Every piece on the six-item menu is inexpensive and delicious.
los angeles timessouth baysushirestauranthomestyle
https://sfbay.craigslist.org/sby/fuo/d/san-jose-white-drawer-dresser-for/7928881468.html
south bay furniture - by owner - craigslist
south bay furniture - by owner - craigslist
south bayfurnitureownercraigslist
https://www.meetup.com/south-bay-knit-crochet/events/314208226/
South Bay Knit and Crochet Gathering, Wed, Apr 29, 2026, 6:30 PM | Meetup
We are a group of crafters who meet weekly to work on knitting, crocheting, and other needle arts. Come join us to finally finish that second sleeve, get...
apr 29 2026south bayknitcrochetgathering
https://www.siliconvalley.com/2026/03/20/google-mountain-view-nasa-hangar-one-historic-build-nasa-tech-jobs/
Google completes massive project to restore Hangar One in South Bay
Mar 23, 2026 - Google has completed a massive project to restore and revamp Hangar One in the South Bay, a restoration that
south baygooglecompletesmassiveproject
https://ridegtrans.com/
Welcome to GTrans, the smartest way around the South Bay
welcome tosouth baywayaround
https://www.meetup.com/isha-yoga-inn-engineering-san-fransisco-yoga-meditation/events/234474136/
🌱 Save Soil Walkathon – South Bay, Sun, Apr 26, 2026, 9:00 AM | Meetup
https://tinyurl.com/SSW26-SFSouthBay Imagine a future where the soil beneath our feet can no longer grow food… Let’s come together to raise awareness and take...
apr 26 2026south baysavesoilsun
https://www.design-scapes-inc.com/
Design Scapes | West LA & South Bay Landscape Design-Build
west lasouth baydesignlandscapebuild
https://www.kqed.org/checkplease/restaurants-a-z/peninsulasouth-bay-restaurants
Peninsula/South Bay Restaurants A-Z | KQED
Every Peninsula/South Bay restaurant ever featured on 'Check, Please! Bay Area.' Come browse restaurants, re-watch your favorite segments, and enjoy food...
south baypeninsularestaurantskqed
https://www.fireislandnews.com/arts-culture/book-reviews/ernie-fazio-1939-2026/
Ernie Fazio, Long Island Environmental Visionary (1939-2026) » Fire Island News & Great South Bay...
Apr 18, 2026 - Great South Bay News reports the passing of Ernie Fazio with deep sadness. Born in Howard Beach, NY, on December 29, 1939, Mr. Fazio passed on March 13, 2026,
long islandfire newssouth bayernieenvironmental
https://www.meetup.com/south-bay-knit-crochet/events/312958605/
South Bay Knit & Crochet Weekend Crafting - Saturdays, Sat, May 2, 2026, 3:00 PM | Meetup
Hey Crafters! We’re excited to announce a weekend edition of our craft meetup! If weeknight commitments have kept you from joining, here’s your chance to...
south baymay 2knitcrochetweekend
https://www.fireislandnews.com/fair-harbor/
Fair Harbor News » Fire Island News & Great South Bay News
fire islandsouth bayfairharbornews
https://sfbay.craigslist.org/sby/rid/d/anybody-need-ride/7923499328.html
south bay rideshare - craigslist
south bay rideshare - craigslist
south bayridesharecraigslist
https://www.southbaycu.com/
South Bay Credit Union | Live Here. Work Here. Welcome. Here.
Apr 9, 2026 - South Bay Credit Union has a super competitive lending solution for every phase of your life to help you secure your financial future
south baycredit unionlive hereworkwelcome
https://sf.eater.com/maps/best-san-jose-south-bay-area-restaurants
25 Best San Jose and South Bay Area Restaurants | Eater SF
Standout restaurants in Santa Clara County for an array of appetites and price points
san josesouth bayarea restaurantsbesteater
https://issuu.com/metrosiliconvalley/stacks/a27e070660c74e44af2ccc3cbbcc9a9b
Explore - South Bay Stack - Issuu
south bayexplorestackissuu
https://www.airbnb.com/hout-bay-cape-town-south-africa/stays/luxury
Hout Bay, South Africa Luxury Vacation Rentals | Airbnb
Apr 29, 2026 - Find your perfect luxury vacation rental for your trip to Hout Bay, South Africa. Over 5000 Properties. No membership fees. 24/7 Guest service....
hout baysouth africavacation rentalsluxuryairbnb
https://adultsearch.com/za/mossel-bay/
Mossel Bay South Africa Escorts, Strip Clubs, Massage Parlors and Sex Shops
Mossel Bay South Africa Escorts, Strip Clubs, Massage Parlors and Sex Shops
south africa escortsmossel baystrip clubsmassage parlorssex shops
https://www.monkeyland.co.za/
Monkeyland Primate Sanctuary, Plettenberg Bay, South Africa
Monkeyland is the worlds first free roaming multi-specie primate sanctuary. Eco-tourism child friendly activity, educating visitors on wildlife conservation
plettenberg baysouth africaprimatesanctuary
https://www.exoticsouthafrica.com/escorts-from/sarah-baartman/jeffreys-bay-escorts/
Jeffreys Bay Escorts for Private Companionship in South Africa
Discover trusted Jeffreys Bay escorts for discreet, sensual companionship in this peaceful surf town. Verified profiles. Easy bookings.
jeffreys bayfor privatesouth africaescortscompanionship
https://www.exoticsouthafrica.com/escorts-from/o-r-tambo/coffee-bay-escorts/
Coffee Bay Escorts – Wild Coast Companions in South Africa
wild coastsouth africacoffeebayescorts
https://tampaescortstate.com/model/sun-bay-south-tampa
Sun Bay South Escorts Guide - Sun Bay South Female Escorts - TampaEscortState
Browse the most beautiful Sun Bay South area Escort on Tampa Escort State Guide. High-class female adult entertainers in Sun Bay South, Photo Verified, and VIP...
sun bay southescortsguidefemale
https://www.parks.sa.gov.au/experiences/seal-bay
Seal Bay - National Parks and Wildlife Service South Australia
Feb 12, 2026 - Seal Bay With its unspoiled wilderness and stunning beauty, it is no surprise that Kangaroo Island (KI) is consistently in South Australia’s top ten…
seal baynational parkssouth australiawildlifeservice
https://www.newsgd.com/
South | Guangdong News, Guangdong-Hong Kong-Macao Greater Bay Area, Opinions, Business, Lifestyle,...
greater bay areahong kongsouthguangdongnews
https://www.mercurynews.com/2026/01/26/vote-now-bay-area-news-group-girls-athlete-of-the-week-158/
Bay Area high school girls athlete of week, East Bay, South Bay, Peninsula
Jan 29, 2026 - Make your choice for the top performance among girls high school athletes from Jan. 19-24
bay areahigh schoolgirlsathleteweek
https://millerferry.com/
Miller Ferry – Miller Passenger & Vehicle Ferries to Put-in-Bay (South Bass Island) & Middle Bass...
Ferries to Put-in-Bay and Middle Bass
millerferrypassengervehicleferries
https://massagerepublic.com/female-escorts-in-richards-bay
Escort Richards Bay, South Africa
We have 1 Richards Bay escorts on Massage Republic, The average cost advertised is R248 (US$14).
richards baysouth africaescort
https://southaustralia.com/products/kangaroo-island/attraction/raptor-domain
Raptor Domain - Seal Bay, Attraction | South Australia
Raptor Domain is home to the only free flight Birds of Prey presentation in South Australia. As well as daily Reptile presentations.
seal baysouth australiaraptordomainattraction
https://www.mercurynews.com/2026/04/21/high-school-softball-rankings-april-21-2026-bay-area-news-group-top-20/
Bay Area high school girls softball rank, East Bay, South Bay, Peninsula
Apr 21, 2026 - Livermore leads the way as St. Francis picks up big wins over Valley Christian, Willow Glen
bay areahigh schoolgirlssoftballrank
https://www.exoticsouthafrica.com/escorts-from/sarah-baartman/oyster-bay-escorts/
Oyster Bay Escorts – Coastal Intimacy Redefined in South Africa
Book Oyster Bay escorts for discreet beachside passion and sensual companionship. Relaxed, verified, and intimate. Start your booking today.
oyster baysouth africaescortscoastalintimacy
https://www.naughtyads.com.au/escort/zara-bubbly-little-blonde
Zara - Female Escort in Napier South, 4143 Hawke's Bay NZ - Naughty Ads
Zara - Female Escort in Napier South, 4143 Hawke's Bay NZ. Find Adult Services now on Naughty Ads
female escortnaughty adszaranapiersouth
https://www.mercurynews.com/2026/02/23/vote-now-bay-area-news-group-girls-athlete-of-the-week-162/
Bay Area high school girls athlete of week, East Bay, South Bay, Peninsula
Feb 26, 2026 - Make your choice for the top performance among girls high school athletes from Feb. 16-21
bay areahigh schoolgirlsathleteweek
https://www.mercurynews.com/2026/04/24/bay-area-news-group-girls-athlete-of-the-week-celia-hernandez-san-mateo-softball/
Bay Area high school girls athlete of week, East Bay, South Bay, Peninsula
Apr 24, 2026 - Hernandez pitched six scoreless innings in a win over Mountain View, three in a win over Carlmont and went the distance with one run allowed on three hits in a...
bay areahigh schoolgirlsathleteweek