Robuta

https://us.getacgroup.com/news/ins.php?index_id=116
Getac Technology Corporation began its recruitment on March 5, 2017, sending in the Getac Scout Special Operations Force (SOF) to announce its recruitment for...
southern taiwangetacschoolrecruitmentnorthern
https://www.digitimes.com/news/a20250825PD218/2025-semiconductors-kaohsiung-taiwan-industrial.html
Aug 26, 2025 - The 2025 Meet Greater South, held August 22-23 at the Kaohsiung Exhibition Center, brought together 300 startup teams from nine countries. Centered on the...
southern taiwanglobalsemiconductorhub
https://focustaiwan.tw/society/202307250034
The periphery of typhoon Doksuri is likely to reach the Hengchun Peninsula Wednesday morning and is expected to bring strong winds and heavy rainfall to...
typhoon doksuriheavy rainsouthern taiwanbringeastern
https://sapdc.net/events/ai-expo-taiwan/
BusinessPA secured a booth and invites companies to a free event in Taiwan to showcase your AI, robotics, manufacturing, and energy innovations. AI Expo...
development commissionaiexposouthernalleghenies
https://www.twz.com/news-features/marine-himars-deployment-to-southern-japanese-islands-during-taiwan-crisis-detailed-in-report
The U.S. Army's Multi-Domain Task Force and its long-range missiles would also purportedly deploy to the Philippines.
japanese islandsmarinehimarsdeploymentsouthern
https://www.taipeitimes.com/News/taiwan/archives/2002/11/19/0000180124
Bringing Taiwan to the World and the World to Taiwan
southern taiwanmilitaryenlistedhelpfight