https://www.kanalcoin.com/us-spot-bitcoin-etfs-24197-btc-10-days-miner-production/
U.S. Spot Bitcoin ETFs Added 24,197 BTC in 10 Days
Apr 25, 2026 - U.S. spot Bitcoin ETFs accumulated 24,197 BTC in 10 days, exceeding estimated miner output and spotlighting a tightening supply-demand setup.
spot bitcoin etfsaddedbtcdays
https://forkast.news/us-spot-bitcoin-etf-crypto-silver-bullet/
US spot Bitcoin ETF — crypto’s silver bullet?
Oct 25, 2023 - Amid rumors of an imminent approval for at least one spot Bitcoin ETF, Bitcoin’s price is skyrocketing. Could a year of pain in the crypto industry be over?
spot bitcoinusetfsilverbullet
https://dacfp.com/about-spot-bitcoin-etfs/
About Spot Bitcoin ETFs - DACFP
Aug 30, 2023 - Tune in to this fascinating webinar where Ric Edelman and Bitwise CIO Matt Hougan reveal the current and future uses of crypto in business and our everyday...
spot bitcoin etfsdacfp
https://rationalreminder.ca/podcast/293
Episode 293 - Eric Balchunas: Spot Bitcoin ETFs — Rational Reminder
Jul 25, 2024 - Eric Balchunas is Senior ETF Analyst at Bloomberg Intelligence, where he leads the ETF and passive fund research and contributes to Bloomberg Opinion. He is a...
spot bitcoin etfsepisodeericrationalreminder
https://www.kanalcoin.com/spot-bitcoin-etf-outflows-top-490m/
Spot Bitcoin ETF Outflows Top $490M as Sentiment Weakens
May 1, 2026 - Spot Bitcoin ETF outflows topped $490 million, pointing to weaker market sentiment. Here is what the withdrawal wave means for Bitcoin and traders.
spot bitcoinetfoutflowstopsentiment
https://www.tdsecurities.com/ca/en/spot-bitcoin-etfs-in-the-us
Spot Bitcoin ETFs Arrive in the U.S. | TD Securities
With the simultaneous approval of eleven spot Bitcoin ETFs and an aggressive fee war, read how the SEC and these new funds may be using lessons learned from...
spot bitcoin etfsarrivetdsecurities
https://www.blocktrainer.de/blog/ex-sec-abteilungsleiter-glaubt-nicht-an-genehmigung-btc-etf
Ehemaliger SEC-Abteilungsleiter glaubt nicht an Genehmigung eines Spot Bitcoin-ETFs! | Blocktrainer...
Blocktrainer behandelt aktuelle News rund um Bitcoin und liefert tiefgehende Blog-Artikel zu wirtschaftlichen und technischen Themen mit BTC-Bezug.
spot bitcoin etfsehemaligersecabteilungsleiterglaubt
https://en.spaziocrypto.com/usa/us-cftc-approves-leveraged-bitcoin-spot-trading/
CFTC: Spot Bitcoin Trading with Leverage in the US Starts
Dec 6, 2025 - The CFTC authorises the first leveraged spot trading on Bitcoin in the US, opening it up to large investors.
spot bitcoincftctradingleverageus
https://www.gncrypto.news/news/us-spot-bitcoin-etfs-five-week-inflow-streak/
U.S. Spot Bitcoin ETFs Hit Five-Week Inflow Streak
U.S. spot Bitcoin ETFs posted five straight weeks of inflows totaling $3.8B, pushing assets to a record $108.76B as option hedges unwind.
spot bitcoin etfshitfiveweekinflow
https://block24.ai/tin-tuc/detail/dong-von-do-bo-spot-bitcoin-etf-9-ngay-lien-tiep
Dòng vốn đổ bộ Spot Bitcoin ETF 9 ngày liên tiếp
Thị trường crypto đang chứng kiến một tín hiệu cực kỳ lạc quan khi các quỹ Spot Bitcoin ETF tại Mỹ vừa ghi nhận chuỗi ngày inflow kéo dài nhất trong nhiều...
spot bitcoinetf
https://thecoinomist.com/news/blackrock-inflows-us-spot-bitcoin-etfs-1-69b-5-days/
BlackRock Inflows Push U.S. Spot Bitcoin ETFs $1.69B in 5 Days
May 7, 2026 - U.S. spot Bitcoin ETFs saw five-day net inflows of $1.69B, led by BlackRock's IBIT with $134.6M. Bitcoin near $82K amid broader crypto rally.
spot bitcoin etfsblackrockinflowspushdays
https://coincu.com/two-months-2nd-final-spot-bitcoin-etf-deadline/
Two Months To The 2nd Final Spot Bitcoin ETF Deadline: What's Next?
May 21, 2026 - Invest in Bitcoin through Spot Bitcoin ETFs, which provide indirect exposure to Bitcoin without owning it. Learn about the advantages, history, major financial...
two monthsspot bitcoinfinaletfdeadline
https://www.garp.org/risk-intelligence/market/spot-bitcoin-240126
Have Spot Bitcoin ETFs Changed the Digital-Asset Game?
Jan 26, 2024 - Explore SEC-approved crypto products with insights from BlackRock's CEO on the evolving landscape of political, risk, and business strategies. Read more!
spot bitcoin etfsdigital assetchangedgame
https://forkast.news/spot-bitcoin-etfs-hong-kong-crypto-throne/
Can spot Bitcoin ETFs push Hong Kong to the crypto throne?
Nov 9, 2023 - Top blockchain and crypto news: Hong Kong mulls Bitcoin ETFs, Ordinals flip Ethereum NFTs, IPO comes full circle.
spot bitcoin etfshong kongpushcryptothrone
https://aminagroup.com/research/approval-of-11-spot-bitcoin-etfs/
Approval of 11 Spot Bitcoin ETFs: The Dawn of a New Era
Jan 24, 2024 - The U.S. Securities and Exchange Commission has approved 11 new spot Bitcoin ETFS, including the ones from BlackRock or Fidelity.
spot bitcoin etfsapprovaldawnnewera
https://www.globalcryptopress.com/2026/04/wall-streets-12-trillion-giant-charles.html
Wall Street's $12 TRILLION GIANT, Charles Schwab, Opening a Waitlist for Spot Bitcoin and Ethereum...
Cryptocurrency News Live and Breaking in Real-Time! Current crypto coin prices, analysis, and predictions from the Global Crypto Press Association.
wall streetcharles schwabspot bitcointrilliongiant
https://phemex.com/blogs/bitcoin-etf-inflows-238-million-single-day?ref=tftc.io
Spot Bitcoin ETFs Hit 5-Day Inflow Streak | $238M Spike Signals Institutional Shift 2026
Apr 23, 2026 - US spot BTC ETFs recorded five consecutive days of net inflows through April 22, including a single-day $238M spike pushing total AUM above $96.5B. Here's what...
spot bitcoin etfshitdayinflowstreak
https://webscrypto.com/seoul-advances-crypto-overhaul-with-spot-bitcoin-etfs-and-stablecoin-launch/
Seoul Advances Crypto Overhaul with Spot Bitcoin ETFs and Stablecoin Launch
Jun 5, 2025 - The administration will allow domestic spot BTC ETFs, introduce a won-backed stablecoin, relax institutional caps, and update exchange licensing by 2026.
spot bitcoin etfsseouladvancescryptooverhaul
https://www.globalcryptopress.com/search/label/spot%20bitcoin%20etf
spot bitcoin etf - Cryptocurrency News Live | Breaking Crypto News - Realtime Prices, Analysis,...
Cryptocurrency News Live and Breaking in Real-Time! Current crypto coin prices, analysis, and predictions from the Global Crypto Press Association.
cryptocurrency news livespot bitcoinrealtime pricesetfbreaking
https://www.globalcryptopress.com/search/label/spot%20bitcoin%20brokerage
spot bitcoin brokerage - Cryptocurrency News Live | Breaking Crypto News - Realtime Prices,...
Cryptocurrency News Live and Breaking in Real-Time! Current crypto coin prices, analysis, and predictions from the Global Crypto Press Association.
cryptocurrency news livespot bitcoinbrokeragebreakingrealtime
https://www.johnnybitcoin.com/spot-bitcoin-etfs-explained-1
Spot Bitcoin ETFs Explained | How it Works and How to Invest
spot bitcoin etfsexplainedworksinvest
https://www.1millionfreepictures.com/2025/07/the-etf-effect-how-spot-bitcoin-etfs.html
The ETF Effect: How Spot Bitcoin ETFs Are Reshaping Market Dynamics
Jul 16, 2025 - Public domain pictures and copyright free photos. Royalty Free pictures. Stock photos.
spot bitcoin etfseffectreshapingmarketdynamics
https://www.kanalcoin.com/river-strc-inflows-surpassed-spot-bitcoin-etf-net-inflows-2/
River: STRC Inflows Surpass Spot Bitcoin ETF Net Inflows
May 1, 2026 - River says STRC inflows have moved past spot Bitcoin ETF net inflows. This outline focuses on the claim, why the comparison matters, and what to watch next.
spot bitcoinriverinflowssurpassetf
https://cryptocoin.news/news/spot-bitcoin-etfs-plunge-below-100b-on-272m-outflows-210799/
Spot Bitcoin ETFs Plunge Below $100B on $272M Outflows - CryptoCoin.News
Spot Bitcoin ETFs slip below $100B AUM to $97.9B after $272M outflows, with BlackRock's IBIT and Fidelity's FBTC hit hardest. YTD losses at $1.3B amid...
spot bitcoin etfsplungeoutflowscryptocoinnews
https://coinliners.nl/nieuws/amerikaanse-spot-bitcoin-etfs-noteren-in-april-bijna-2-mrd-instroom-ether-etfs-voor-het-eerst-sinds-oktober-weer-positief/
Amerikaanse spot Bitcoin-ETF’s noteren in april bijna $2 mrd instroom; Ether-ETF’s voor het eerst...
De instroom in Amerikaanse spot Bitcoin- en Ether-ETF’s laat zien dat de interesse van beleggers in digitale activa opnieuw aantrekt. In april werd er volgens...
spot bitcoinvoor hetamerikaansenoterenapril
https://www.gsr.io/insights/the-long-and-arduous-road-towards-a-us-spot-bitcoin-etf
The Long and Arduous Road Towards a US Spot Bitcoin ETF | GSR Markets
May 20, 2025 - GSR is the global leader in crypto trading and market-making. We specialize in providing liquidity, trading and risk management solutions.
spot bitcoinlongroadtowardsus
https://www.garp.org/risk-intelligence/market/spot-bitcoin-etps-dominate-241122
Spot Bitcoin ETPs Dominate Even as Ether Offers Alternatives
Nov 22, 2024 - Staking methods and due-diligence requirements influence institutional interest in the market. Explore more!
spot bitcoinetpsdominateevenether
https://www.gncrypto.news/news/spot-bitcoin-etfs-nearly-1b-inflows-btc-81000/
Spot Bitcoin ETFs Draw Nearly $1B Inflows as BTC Tops $81,000
Spot Bitcoin ETFs posted $999M in two-day inflows as BTC topped $81,000, lifting total ETF AUM near $109B and cumulative inflows to $59.7B.
spot bitcoin etfsdrawnearlyinflowsbtc
https://crypto-economy.com/spot-bitcoin-etfs-five-day-inflows-1-7b/
Spot Bitcoin ETFs Extend Inflow Streak to Five Days, Approaching $1.7B Total - Crypto Economy
May 7, 2026 - Spot Bitcoin ETFs in the U.S. extended their momentum on Wednesday, securing a fifth straight day of net inflows and pushing combined.
spot bitcoin etfsfive daysextendinflowstreak
https://www.bibox.com/en/exchange/basic/XCH_USDT
Bitcoin spot transaction|token transaction|encrypted digital currency transaction|btc-usdt...
Bibox exchange provides you with professional bitcoin spot trading, token trading, encrypted digital currency and other trading services. And supports standard...
bitcoin spotdigital currencytransactiontokenencrypted
https://www.hedgewithcrypto.com/is-bitcoin-a-ponzi-scheme/
Bitcoin Ponzi Schemes: What Are They & How To Spot Them
Dec 19, 2025 - Bitcoin has been accused of being a ponzi scheme. This article will explain why Bitcoin isn't a ponzi scheme and explain the key differences the two.
bitcoinponzischemesspot
https://finbold.com/bitcoin-spot-etfs-record-4-consecutive-days-of-inflows-of-over-1-6-billion/
Bitcoin spot ETFs record 4 consecutive days of inflows of over $1.6 billion
May 6, 2026 - The U.S. spot Bitcoin ETFs have recorded four consecutive days of cash inflows, thereby bolstering the coin’s bullish outlook.
bitcoin spotetfsrecordconsecutivedays
https://forkast.news/uptober-spot-bitcoin-etf-bounce-narrative/
Bitcoin's ‘Uptober’ saved by spot ETF bounce
Oct 31, 2023 - October has once again produced an upswing in the crypto market, with excitement around a potential U.S. spot Bitcoin ETF to thank for this year’s ‘Uptober.’
spot etfbitcoinsavedbounce
https://www.blocktrainer.de/blog/blackrock-reicht-antrag-fuer-eigenen-bitcoin-spot-etf-ein
Blackrock reicht Antrag für eigenen Bitcoin-Spot-ETF ein | Blocktrainer - Bitcoin Bildung & News
Blocktrainer behandelt aktuelle News rund um Bitcoin und liefert tiefgehende Blog-Artikel zu wirtschaftlichen und technischen Themen mit BTC-Bezug.
bitcoin spotblocktrainer bildungblackrockreichtantrag
https://www.echobit.com/
Echobit | Bitcoin & ETH Futures & Spot Trading | Crypto Exchange
Echobit is a secure crypto exchange for trading Bitcoin (BTC), Ethereum (ETH), and altcoins in Spot and Perpetual Futures markets
bitcoin ethspot tradingfuturescryptoexchange
https://www.coinglass.com/etf/bitcoin
Bitcoin ETF Fund Flows | Spot BTC Net Inflow & Holdings | CoinGlass
Explore the latest Bitcoin ETF market trends. CoinGlass provides you with a comprehensive Bitcoin ETF tracker and overview,Bitcoin ETF Flows ,Bitcoin ETF...
bitcoin etffundflowsspotbtc
https://www.bitcoininsider.org/article/302771/kucoin-will-adjust-tick-size-certain-spot-trading-pairs
KuCoin Will Adjust the Tick Size for Certain Spot Trading Pairs | Bitcoin Insider
May 7, 2026 - In order to increase market liquidity and improve trading experience, KuCoin will be adjusting the tick size (i.e., the minimum change in the unit price) of...
tick sizespot tradingkucoinadjustcertain
https://www.blocktrainer.de/blog/morgan-stanley-reicht-antrag-fuer-bitcoin-spot-etf-ein
Morgan Stanley reicht Antrag für Bitcoin-Spot-ETF ein
Jan 6, 2026 - Morgan Stanley hat einen Antrag für einen Bitcoin-Spot-ETF bei der SEC eingereicht. Ein besonderer Schritt, da die Großbank kein typischer ETF-Herausgeber ist.
morgan stanleybitcoin spotreichtantragetf
https://www.xt.com/en/trade/btc_usdt?type=margin
BTC USDT | BTCUSDT Charts & Trade Info | Bitcoin Spot/Margin Trading | XT.com
Buy, sell and trade BTC/USDT securely with XT crypto exchange. View BTC to USDT live price chart and order history information to track latest bitcoin price...
charts trade infospot margin tradingbtc usdtbtcusdtbitcoin
https://www.todayonchain.com/news/article/01KR21CAA8B86M0NB9GXV8S8W8/
Bitcoin Slips Below $80K As Spot ETF Inflows Top $1B - TodayOnChain
Bitcoin fell below $80,000 despite over $1 billion in weekly spot ETF inflows, with technical indicators suggesting a short-lived correction.
spot etfbitcoinslipsinflowstop
https://www.altcoiners.live/news/Bitcoin/51
Bitcoin Surpasses Silver To Claim 8th Spot As Largest Asset In The World - Altcoiners
Bitcoin Surpasses Silver To Claim 8th Spot As Largest Asset In The World...
bitcoinsurpassessilverclaimspot
https://unblock.ch/blog/2025/08/08/cftc-eyes-crypto-spot-trading-bullish-ipo-indonesia-considers-bitcoin-reserves-ripple-expands-stablecoin-payments-eth-breaks-4k/
CFTC Eyes Crypto Spot Trading, Bullish IPO, Indonesia Considers Bitcoin Reserves, Ripple Expands...
spot tradingcftceyescryptobullish
https://phemex.com/onchain/trade/Solana-FasH397CeZLNYWkd3wWK9vrmjd1z93n3b59DssRXpump
BUTTCOIN 0.00022358980 - The Next Bitcoin (BUTTCOIN) On-chain Spot Market Trading
Trade The Next Bitcoin (BUTTCOIN) token securely on Phemex Onchain's spot market. Enjoy zero gas fees, fast execution, and one-click trading with no Web3...
spot marketnextbitcoinchaintrading
https://coincu.com/bitcoin-spot-etf-explained-you-need-to-know/
Bitcoin Spot ETF Explained: All Things You Need To Know!
Feb 27, 2025 - Bitcoin Spot Exchange-Traded Fund (Bitcoin Spot ETF) represents a new investment opportunity that allows investors to gain exposure to the price movements of...
bitcoin spotetfexplainedthingsneed