https://www.htx.com/feed/news/446659/
Total amount of staking Ethereum is nearly 16 million
According to data from Dune Analytics, the total amount of staking ETH on the Ethereum Beacon Chain
staking ethereumtotalamountnearly16
https://www.ethpool.org/
Ethpool Staking - Ethereum Staking Pool 2026
Ethereum staking made easy. Earn rewards and stay in full control of your ETH. Join us for secure, non-custodial staking without hardware hassles.
staking ethereumpool2026
https://www-ether-fi.webflow.io/
Ether.Fi : Staking Ethereum Platform | Ether Fi
Ether.fi is a non-custodial Ethereum liquid restaking protocol that lets users stake ETH, retain validator control, and earn enhanced rewards.
staking ethereumfiplatform
https://ethereum.org/id/contributing/adding-staking-products/
Menambahkan produk atau layanan staking | ethereum.org
Kebijakan yang kami gunakan saat menambahkan produk atau layanan staking ke ethereum.org
staking ethereumproduklayanan
https://ethereum.org/it/contributing/adding-staking-products/
Aggiungere prodotti o servizi di staking | ethereum.org
La politica che utilizziamo quando aggiungiamo prodotti o servizi di staking su ethereum.org
staking ethereumaggiungereprodottiservizidi
https://ethpool.org/
Ethpool Staking - Ethereum Staking Pool 2026
staking ethereumpool2026
https://www.divastaking.net/
Diva Staking | Ethereum most decentralized Liquid Staking protocol
Diva Staking is an Ethereum Liquid Staking protocol powered by distributed validators and a set of permissionless node operators. Join our community and become...
staking ethereumdivadecentralizedliquidprotocol
https://www.okx.com/en-us/learn/ethereum-restaking-eigenlayer-liquid-tokens
Ethereum Restaking Revolution: How EigenLayer and Liquid Tokens Are Reshaping Staking Dynamics |...
OKX United States - Discover how EigenLayer and liquid tokens are transforming Ethereum staking. Explore the restaking revolution reshaping blockchain dynamics...
https://decrypt.co/104064/lido-community-signals-intent-keep-ethereum-staking-uncapped
Lido Community Signals Intent to Keep Ethereum Staking Uncapped - Decrypt
Jun 29, 2022 - The Lido community is currently voting against a proposal that would limit how much Ethereum can be staked on the platform.
to keepethereum stakinglidocommunitysignals
https://cryptoslate.com/ethereums-beam-chain-proposal-promises-streamlined-staking-and-enhanced-security/
Ethereum's Beam Chain proposal promises streamlined staking and enhanced security
Nov 12, 2024 - Beam Chain's ambitious agenda aims at bridging Ethereum's capability gap for heightened performance and inclusivity.
s beamethereumchainproposal
https://coinmarketcap.com/academy/article/binance-introduces-ether-based-liquid-staking-product-amid-ethereum-2.0-transition
Binance Introduces Ether-based Liquid Staking Product Amid Ethereum 2.0 Transition | CoinMarketCap
Binance, one of the world's largest cryptocurrency exchanges, has announced the launch of an Ether-based liquid staking product.
https://www.finanznachrichten.de/nachrichten-2026-04/68172507-ethereum-prognose-dreht-bullisch-grayscale-staking-etf-erreicht-nyse-doch-ein-presale-verwandelt-angst-in-den-einstieg-des-jahre-712.htm
Ethereum Prognose dreht bullisch, Grayscale Staking-ETF erreicht NYSE, doch ein Presale verwandelt...
Anzeige / WerbungDie Ethereum Prognose verschob sich am 6. April, als Grayscale seinen Ethereum Staking-ETF an der NYSE Arca startete, mit institutionellen...
https://cryptoslate.com/ark-and-21shares-drop-staking-from-spot-ethereum-etf-proposal/
Ark Invest, 21Shares drop staking from spot Ethereum ETF proposal
May 11, 2024 - Ark Invest and 21 Shares dropped staking plans in their updated spot Ethereum ETF proposal on May 10.
ark investethereum etf21sharesdropstaking
https://decrypt.co/343051/grayscale-ethereum-etfs-first-us-add-staking
Grayscale Ethereum ETFs Are First in US to Add Staking - Decrypt
Oct 6, 2025 - Grayscale's new feature eliminates a major pain point for Ethereum ETFs: the absence of staking rewards for institutional investors.
ethereum etfsin usto addgrayscalefirst
https://finviz.com/quote?t=ETH&ta=1&p=d&ty=dv
ETH - Grayscale Ethereum Staking Mini ETF Dividends
ETH - Grayscale Ethereum Staking Mini ETF - Stock screener for investors and traders, financial visualizations.
ethereum stakinggrayscaleminietfdividends
https://www.newsbtc.com/ethereum-news/binance-ethereum-supply-hits-2020-levels-while-staking-locks-a-third-repricing-ahead/
Binance Ethereum Supply Hits 2020 Levels While Staking Locks A Third: Repricing Ahead?
Apr 28, 2026 - Ethereum holds above $2.3K as 31% of supply is locked and exchange reserves hit 2020 lows, setting up a potential repricing
https://capital.com/de-de/market-updates/ethereum-price-prediction-26-03-2026
Ethereum Prognose | BlackRock Staking-ETF | Capital.com Deutschland
Erkunden Sie Ethereum-Kursprognosen von Drittanbietern mit technischer Analyse, CFD-Sentiment, ETH-Kursverlauf und Capital.com Analystenansicht.
ethereum prognoseblackrockstakingetfcapital
https://www.analyticsinsight.net/news/ethereum-news-today-eth-staking-inflows-surge-to-multi-year-highs-as-exit-queue-hits-zero
Ethereum News Today: ETH Staking Inflows Surge to Multi-Year Highs as Exit Queue Hits Zero
Ethereum News Today: ETH validator exit queue hits zero as the entry backlog tops 2.6 million units, tightening supply signals while staking yields near 2.8%...
https://www.okx.com/en-us/learn/ethereum-whales-staking-institutional-interest
Ethereum Whales Drive Accumulation Surge Amid Staking Milestone and Institutional Interest | OKX...
OKX United States - Ethereum whales are reshaping the crypto market landscape, with notable accumulation and staking activity observed across multiple wallets.
ethereum whales
https://www.okx.com/en-us/learn/ethereum-sharplink-mnav-staking-transparency
Ethereum, SharpLink, and mNAV: Unlocking Value Through Staking and Transparency | OKX United States
OKX United States - Discover how Ethereum, SharpLink, and mNAV are revolutionizing staking with transparency and unlocking new value in the crypto ecosystem.
ethereum sharplink
https://cryptoslate.com/rex-osprey-unveils-first-ethereum-staking-etf-amid-cooling-investor-appetite/
REX-Osprey laucnhes first Ethereum staking ETF in US
Sep 25, 2025 - REX-Osprey offers first Ethereum staking ETF in US, passing full staking rewards to investors without deductions.
ethereum stakingrexospreyfirstetf
https://stockhouse.com/companies/ratios?symbol=eth
ARCA:ETH | Company Fundamentals | Grayscale Ethereum Staking Mini ETF
Explore key ratios, efficiency ratios, dividends, and other fundamentals for Grayscale Ethereum Staking Mini ETF (ARCA:ETH). Use concise and easy to view...
company fundamentalsethereum stakingarcagrayscalemini
https://decrypt.co/107700/coinbase-ceo-wed-shut-down-ethereum-staking-if-threatened-by-regulators
Coinbase CEO: We'd Shut Down Ethereum Staking If Threatened by Regulators - Decrypt
Aug 18, 2022 - Asked if he would choose to censor transactions or get out of the ETH staking business, Brian Armstrong said he'd choose the latter.
https://finviz.com/news/342741/bit-digital-inc-reports-monthly-ethereum-treasury-and-staking-metrics-for-march-2026
Bit Digital Inc. Reports Monthly Ethereum Treasury and Staking Metrics for March 2026
Stock screener for investors and traders, financial visualizations.
https://consensys.io/teku
Teku | Ethereum 2.0 Client for Institutional Staking | Consensys
Teku is the Ethereum 2.0 client empowering businesses to stake on the next evolution of the Ethereum network
ethereum 2 0tekuclientinstitutionalstaking
https://motif.finance/
MOTIF - The first in-kind bitcoin staking DTP on ethereum
Transform your bitcoin into an active, yield-generating asset with MOTIF staking DTP protocol on ethereum
the firstin kindbitcoin stakingmotifdtp
https://www.gate.com/blog/gate-eth-liquid-staking-earning-ethereum-rewards-while-maintaining-asset-liquidity
Gate ETH Liquid Staking: Earning Ethereum Rewards While Maintaining Asset Liquidity | Gate Blog
Gate ETH liquid staking leverages the GTETH mechanism, enabling users to earn Ethereum staking rewards while maintaining asset liquidity and optimizing capital...
liquid staking
https://consensys.io/blog/understanding-slashing-in-ethereum-staking-its-importance-and-consequences?ref=hackernoon.com
Understanding Slashing in Ethereum Staking: Its Importance & Consequences | Consensys
ethereum stakingunderstandingslashingimportanceconsequences
https://bitcoinist.com/bitstamp-ceases-ethereum-staking/
Bitstamp Ceases Ethereum Staking For US Customers Amid Regulatory Barriers
Aug 24, 2023 - Bitstamp, one of the prominent cryptocurrency exchanges, has announced its decision to terminate Ethereum (ETH) staking services for its US clientele. This
ethereum stakingfor usbitstampcustomersamid
https://www.gadgets360.com/cryptocurrency/news/gemini-crypto-exchange-launch-ethereum-staking-before-the-merge-3268257
Gemini Offers Support for Staking Ahead of Ethereum Network's September 15 Merge Event | Technology...
Aug 19, 2022 - Gemini announced the launch of Gemini Staking, which allows users to stake crypto assets on its exchange. Gemini Staking will initially support Polygon, and...
https://www.coinspeaker.com/valkyrie-coinshares-ethereum-etf-plans/
Valkyrie and CoinShares Drop Ethereum ETF Plans amid No Staking Function - Coinspeaker
May 22, 2024 - Eleanor Terrett revealed that CoinShares and Valkyrie, issuers of spot BTC ETFs, will not apply for a spot ETH ETF.
ethereum etf
https://ethereum.org/staking/withdrawals/?ref=blog.cakedefi.com
Staking withdrawals | ethereum.org
Page summarizing what staking push withdrawals are, how they work, and what stakers need to do to get their rewards
stakingwithdrawalsethereum
https://www.fxempire.com/forecasts/article/ethereum-price-heads-to-3k-as-staking-deposits-hit-85-billion-1409726
Ethereum Price Heads to $3k as Staking Deposits Hit $85 Billion | FXEmpire
Ethereum price crossed the $2,800 milestone on Feb. 15, but rising staking deposits on the ETH 2.0 smart contracts could propel it further towards $3,000.
ethereum price
https://www.htx.com/news/195734/
Verkle Trees promise superior Ethereum solo staking benefits, says Vitalik Buterin | HTX Insights
https://www.fxempire.com/etfs/ethe/advanced-chart
Grayscale Ethereum Staking ETF Shares (ETHE) Stock Live Chart | FXEmpire
View live Grayscale Ethereum Staking ETF Shares stock chart to track the latest price changes. ETHE price chart, real-time data, technical analysis tools, and...
ethereum stakingetf shareslive chartgrayscalestock
https://ethereum.org/id/staking/deposit-contract/
Alamat kontrak deposit staking Ethereum
page-staking-deposit-contract-meta-description
alamatkontrakdepositstakingethereum
https://testnet.rocketpool.net/
Rocket Pool - Decentralised Ethereum Liquid Staking Protocol
rocket poolliquid stakingdecentralisedethereumprotocol
https://www.home.saxo/content/articles/cryptocurrencies/ethereum-staking-reaching-a-wider-audience-17022021
Ethereum staking reaching a wider audience | Saxo
The optionality to stake ETH to earn rewards in the Ethereum 2.0 framework is now becoming easier to access as digital currency exchanges expand their...
ethereum stakingreachingwideraudiencesaxo
https://cryptobriefing.com/grayscale-stakes-102400-eth-via-ethereum-staking-etf-valued-at-237m/
Grayscale stakes 102,400 ETH via Ethereum Staking ETF, valued at $237M
Apr 25, 2026 - Grayscale staked 102,400 ETH worth $237M via its Ethereum Staking ETF. Ethereum reaching $10,000 by December 31, 2026 at 4% YES.
https://decrypt.co/120830/revolut-launches-crypto-staking-ethereum-cardano-polkadot-tezos
Revolut Launches Crypto Staking for Ethereum, Cardano, Polkadot, and Tezos - Decrypt
Feb 8, 2023 - The staking service is the latest from challenger bank Revolut in its ongoing push to make inroads in the crypto industry.
crypto stakingrevolutlaunches
https://crypto.news/valour-debuts-physically-backed-ethereum-staking-etp-on-lse/
Valour debuts physically-backed Ethereum staking ETP on LSE
Sep 30, 2024 - Valour has launched a fully backed Ethereum staking ETP on the London Stock Exchange, marking a new step to decentralized finance in the U.K.
ethereum stakingvalourdebutsphysicallybacked
https://finbold.com/luna-flips-ethereum-2-0-and-solana-by-staking-market-cap/
LUNA flips Ethereum 2.0 and Solana by staking market cap
Mar 11, 2022 - LUNA, has overtaken both Ethereum 2.0 and Solana in staking market capitalization, making it the best performer in this sense on the market.
ethereum 2 0lunaflips
https://ether-fi-etherfi.github.io/
Ether.Fi - Secure Ethereum Staking | ether.fi
Explore Ether.fi, a decentralized Ethereum liquid staking and restaking protocol leveraging EigenLayer to unlock capital efficiency and shared security.
etherfisecurestaking
https://www.coinspeaker.com/robinhood-crypto-rolls-out-ethereum-staking-services-european-customers/
Robinhood Crypto Rolls Out Ethereum Staking Services for European Customers - Coinspeaker
Nov 26, 2024 - The crypto division of the US-based brokerage firm Robinhood has broadened its services by introducing Ethereum staking across Europe.
robinhood cryptoethereum stakingservices forrolls
https://capital.com/it-it/market-updates/ethereum-price-prediction-26-03-2026
Previsioni Prezzo Ethereum | ETF Staking BlackRock | Capital.com
Esplora le previsioni di prezzo Ethereum di terze parti, con analisi tecnica, sentiment CFD, storico prezzi ETH e view degli analisti Capital.com.
ethereum etfprevisioniprezzostakingblackrock
https://decrypt.co/343490/bitwise-21shares-staking-fees-solana-ethereum-etf
Bitwise and 21Shares Add Staking, Slash Fees in Latest Solana and Ethereum ETF Filings - Decrypt
Oct 9, 2025 - New filings from the two crypto ETF issuers suggest that U.S. crypto funds are moving beyond simple price exposure.
https://www.htx.com/feed/news/596176/
Demand for Ethereum Validators Grows as Investors Seek Passive Income from Staking
Cryptocurrency investors looking to profit from their ether (ETH) holdings must wait almost a month
https://stakingqueue.com/
Ethereum Staking Dashboard
ethereum stakingdashboard
https://www.okx.com/en-us/learn/ethereum-institutional-demand-staking-scarcity-etfs
Ethereum's Institutional Surge: Staking, Scarcity, and Spot ETFs Drive Unprecedented Demand | OKX...
OKX United States - Ethereum (ETH) has solidified its position as a cornerstone of the cryptocurrency market, drawing increasing interest from institutional...
https://ethereum.org/staking/saas/
Staking as a service | ethereum.org
Learn about staking as a service
as a servicestakingethereum
https://www.newsbtc.com/ethereum-news/bitmine-locks-68-of-ethereum-holdings-as-staking-position-surpasses-6-75b/
Bitmine Locks 68% of Ethereum Holdings As Staking Position Surpasses $6.75B
Mar 23, 2026 - Ethereum holds above $2,000 as rising selling pressure meets a surge in institutional staking, signaling tightening supply and conviction
https://cryptoslate.com/sec-removes-key-hurdle-for-ethereum-etfs-by-exempting-staking-from-securities-rules/
SEC ruling eases path for Ethereum staking in ETFs
May 30, 2025 - SEC's new guidance reinvigorates crypto staking, potentially amplifying participation across proof-of-stake networks.
ethereum stakingsecrulingpathetfs
https://decrypt.co/353677/grayscales-ethereum-etf-begins-paying-staking-rewards
Grayscale's Ethereum ETF Begins Paying Staking Rewards - Decrypt
Jan 6, 2026 - The Ethereum payout marks the first time a U.S. spot crypto product has distributed protocol-level income to investors.
ethereum etfstaking rewardsgrayscalebeginspaying
https://www.coinspeaker.com/defi-dao-stakewise-ethereum-2-0/
DeFi DAO StakeWise Secures $2M Fund to Simplify Ethereum 2.0 Staking - Coinspeaker
Mar 9, 2021 - Before the launch of the Ethereum 2.0 Proof-of-Stake protocol, StakeWise is now going to streamline the staking process entirely.
https://decrypt.co/315216/hong-kong-approves-ethereum-staking-etf
Hong Kong Approves Latest Ethereum Staking ETF as New Rules Take Root - Decrypt
Apr 17, 2025 - Hong Kong is changing its tune following a new law, approving for the second time an Ethereum ETF with a staking component.
https://ethereum.org/staking/withdrawals/
Staking withdrawals | ethereum.org
Page summarizing what staking push withdrawals are, how they work, and what stakers need to do to get their rewards
stakingwithdrawalsethereum
https://ethereum.org/id/staking/pools/
Staking gabungan | ethereum.org
Pelajari tentang kolam staking
stakinggabunganethereum
https://ethereum.org/staking/
Ethereum staking: How does it work?
An overview of Ethereum staking: the risks, rewards, requirements, and where to do it.
ethereum stakingdoes itwork
https://stake.rocketpool.net/
Rocket Pool - Decentralised Ethereum Liquid Staking Protocol
rocket poolliquid stakingdecentralisedethereumprotocol
https://decrypt.co/78690/ethereum-2-staking-tops-21-billion-merge-horizon
Ethereum 2.0 Staking Tops $21 Billion With 'Merge' on the Horizon - Decrypt
Aug 17, 2021 - The top holder of ETH is now Ethereum 2.0.
ethereum 2 0
https://www.sharedstake.org/
SharedStake | Ethereum Liquid Staking | Earn 4-8% APR
Stake ETH with SharedStake and earn 4-8% APR rewards. No 32 ETH minimum, full liquidity, and DeFi integration. Start staking with as little as 0.01 ETH.
liquid staking4 8ethereumearnapr
https://finviz.com/quote?t=ETH&ta=1&p=d&ty=lf
ETH - Grayscale Ethereum Staking Mini ETF Latest SEC Filings
ETH - Grayscale Ethereum Staking Mini ETF - Stock screener for investors and traders, financial visualizations.
ethereum stakinggrayscaleminietflatest
https://consensys.io/teku?ref=etherworld.co
Teku | Ethereum 2.0 Client for Institutional Staking | Consensys
Teku is the Ethereum 2.0 client empowering businesses to stake on the next evolution of the Ethereum network
ethereum 2 0tekuclientinstitutionalstaking
https://rocketpool.net/
Rocket Pool - Decentralised Ethereum Liquid Staking Protocol
rocket poolliquid stakingdecentralisedethereumprotocol
https://blockswap.network/
Blockswap Network - Ethereum Staking Infrastructure
The home of Multichain ETH. Blockswap supercharges the rollup centric future of Ethereum through composable staked ETH and modular Ethereum Blockspace.
ethereum stakingnetworkinfrastructure
https://www.coinspeaker.com/grayscale-push-sec-approve-ethereum-etf-staking-2k-price/
Grayscale presses SEC on ETH ETF staking as Ethereum targets $2K
Apr 28, 2025 - Grayscale is pushing the SEC to allow ETH staking, unlocking millions in missed rewards. ETH could target $2,000 in the near future.
grayscalepressesseceth
https://www.htx.com/feed/news/332669/
Balance of Ethereum 2.0 Staking Addresses Exceeds $14.2 M
According to data from Huobi Global, the current Ethereum 2.0 deposit contract addresses have receiv
ethereum 2 0balancestakingaddressesexceeds
https://ethereum.org/zh-tw/apps/staking-launchpad/
Ethereum Apps - Staking Launchpad
ethereumappsstakinglaunchpad
https://trustwallet.com/zh-CN/blog/staking/exploring-ether-fi-revolutionizing-ethereum-staking
Exploring Ether.fi: Revolutionizing Ethereum Staking | Trust Wallet
Discover how Ether.fi is changing the game in Ethereum staking with its non-custodial, liquid restaking platform, empowering users with control and flexibility.
ethereum stakingexploringfirevolutionizingtrust
https://www.coinspeaker.com/nl/stijgt-ethereum-koers-macd-indicator/
Breekt Ethereum koers uit door meer staking opbrengst
Mar 12, 2026 - Ethereum koers consolideert nu ETF instroom, hogere staking yields en groeiende DeFi activiteit vertrouwen wekken whales en investeerders.
ethereumkoersuitdoormeer
https://decrypt.co/351469/bitcoin-etf-giant-blackrock-files-launch-ethereum-staking-etf
Bitcoin ETF Giant BlackRock Files to Launch Ethereum Staking ETF - Decrypt
Dec 8, 2025 - Investment firm BlackRock filed the S-1 registration statement for a new Ethereum staking ETF, ETHB, separate from its existing ETHA fund.
bitcoin etfethereum stakinggiantblackrockfiles
https://www.newsbtc.com/ethereum-news/ethereum-solo-staking-made-easier-vitalik-buterin-supports-lower-entry-requirements/
Ethereum Solo Staking Made Easier? Vitalik Buterin Supports Lower Entry Requirements
Oct 4, 2024 - Vitalik Buterin is advocating for reducing the ETH solo staking requirement to lower the entry barrier and promote network decentralization.
solo stakingvitalik buterinethereummadeeasier
https://consensys.io/blog/understanding-slashing-in-ethereum-staking-its-importance-and-consequences
Understanding Slashing in Ethereum Staking: Its Importance & Consequences | Consensys
ethereum stakingunderstandingslashingimportanceconsequences
https://decrypt.co/332399/sec-acknowledges-blackrock-staking-request-ethereum-etf?ref=localhost
SEC Acknowledges BlackRock Staking Request for Ethereum ETF - Decrypt
Jul 30, 2025 - The regulator has extended its decision deadline for similar proposals this year.
staking requestethereum etfsecacknowledgesblackrock
https://www.ledger.com/staking-ethereum
Ethereum (ETH) Staking | Ledger
Mar 5, 2026 - Stake your ETH assets and earn passive income for holding Ethereum (ETH) while contributing to the Ethereum network.
ethereum ethstakingledger
https://www.kucoin.com/news/articles/bitcoin-faces-etf-outflows-ethereum-resilience-solana-s-staking-surge-and-chainlink-s-2025-momentum-dec-27?x=nl_NL&
Bitcoin ETF Outflows, Ethereum Resilience, Solana Staking Surge | KuCoin
Bitcoin faces ETF outflows, Ethereum shows resilience, Solana's staking soars, and Chainlink gains momentum in 2025. Dive into the crypto trends shaping 2025.
bitcoin etf outflowssolana stakingethereumresiliencesurge
https://ethereum.org/staking/deposit-contract/
Ethereum staking deposit contract address
page-staking-deposit-contract-meta-description
ethereum stakingdepositcontractaddress
https://www.chainlabo.com/
Secure Ethereum & Gnosis Staking | Risk-Free Solo Staking with ChainLabo
ChainLabo offers a streamlined staking solution for Ethereum and Gnosis. Ideal solution for those who lack the time or technical expertise to set up staking...
free solosecureethereumgnosisstaking
https://decrypt.co/209867/native-bitcoin-staking-ethereum-solana-soon-reality-babylon
Native Bitcoin Staking on Ethereum and Solana Could Soon Be a Reality - Decrypt
Dec 14, 2023 - Crypto startup Babylon says it's developed a way to stake Bitcoin on any proof-of-stake blockchain. Here's how it works.
https://www.htx.com/feed/news/22341/
Balance of Ethereum 2.0 Staking Addresses Exceeds 9.80 million
According to data from Huobi Global, the current Ethereum 2.0 deposit contract addresses have receiv
ethereum 2 09 80balance
https://crypto.news/ark-21shares-revamps-ethereum-etf-proposal-with-cash-creation-model-and-staking-plan/
ARK 21Shares revamps Ethereum ETF proposal with cash creation model and staking plan
Feb 8, 2024 - ARK 21Shares has recently adjusted its application for a spot Ethereum exchange-traded fund (ETF), shifting towards a cash-creation model akin to its...
https://decrypt.co/108906/ethereum-staking-pools-who-runs-the-largest-ones
Ethereum Staking Pools: Who Runs the Largest Ones? - Decrypt
Sep 3, 2022 - One DeFi staking pool and three centralized crypto exchanges account for almost two-thirds of ETH securing the network ahead of the merge.
ethereum stakingpoolsrunslargestones
https://research.lido.fi/
Lido Governance - Lido - The Ethereum Liquid Staking Community
The governance platform for the Lido DAO.
liquid stakinglidogovernanceethereumcommunity
https://dev.to/walletguy/automated-staking-lido-on-ethereum-jito-on-solana-di9
Automated Staking: Lido on Ethereum, Jito on Solana - DEV Community
Your DeFi trading bot connects to Jupiter for swaps, Aave for lending, Lido for staking, Hyperliquid... Tagged with ai, defi, ethereum, solana.
automatedstakinglidoethereumjito
https://www.htx.com/news/209149/
Fidelity amends spot Ethereum ETF proposal to include staking | HTX Insights
ethereum etffidelityamendsspot
https://www.prnewswire.com/news-releases/falconx-launches-first-ethereum-staking-rate-forwards-fras-referencing-treehouses-tesr-302566999.html
FalconX Launches First Ethereum Staking Rate Forwards (FRAs) Referencing Treehouse's TESR
/PRNewswire/ -- Institutional participants include Edge Capital, Monarq, Mirana, and more, as FalconX facilitates the first Forward transactions based on the...
ethereum staking
https://cryptoslate.com/bitwise-acquires-ethereum-staking-service-attestant-boosting-aum-to-10-billion/?ref=thisweekinfintech.com
Bitwise acquires Ethereum staking service Attestant, boosting AUM to $10 billion
Nov 13, 2024 - The acquisition is part of Bitwise's strategy to deepen its offerings for high-net-worth and institutional clients.
ethereum stakingbitwiseacquiresservice
https://www.okx.com/en-us/learn/ethereum-etfs-institutional-defi-staking
Ethereum ETFs Surge as Institutional Interest in DeFi and Staking Grows | OKX United States
OKX United States - Discover how Ethereum ETFs are gaining momentum as institutional investors dive into DeFi and staking opportunities. Stay ahead in the...
https://consensys.io/staking
Consensys Staking | Self-Custodial Staking on Ethereum
Earn rewards for staking Ethereum with Consensys, the leading Ethereum software company. We make staking secure, reliable, and easy.
consensys stakingselfcustodialethereum
https://crypto.news/from-treasuries-to-validators-sharplink-doubles-down-on-ethereum-staking/
From treasuries to validators: Sharplink doubles down on Ethereum staking
Apr 28, 2026 - Sharplink now stakes nearly 900k ETH as institutional validators, ETFs, and JPMorgan's tokenized funds turn Ethereum's 30% staking era into a yield-bearing
treasuriesvalidatorssharplinkdoublesethereum
https://ethereum.org/staking/?ref=vestorportal.com
Ethereum staking: How does it work?
An overview of Ethereum staking: the risks, rewards, requirements, and where to do it.
ethereum stakingdoes itwork
https://cryptoslate.com/insights/ethereum-staking-exit-queue-hits-record-high-of-over-4-6-billion/
Ethereum staking exit queue hits record high of over $4.6 billion | CryptoSlate
Ethereum staking experiences largest withdrawal queue amid declining deposits, according to data from Validatorqueue.
https://decrypt.co/109234/roll-upgrades-ethereum-social-token-platform-memberships-staking
Roll Upgrades Ethereum Social Token Platform With Memberships, Staking - Decrypt
Sep 8, 2022 - Are social tokens ready for their moment in the crypto spotlight? Roll believes the tech is on the verge of enabling breakout adoption.
social tokenrollupgradesethereumplatform