Robuta

https://footballwing.com/ Get latest Football news, results, stats, Premier League News, La Liga News, Transfer News, Player... latest football newsstats premier league https://goalmalayalamsports.com/ Get latest Football news, results, stats, Premier League News, La Liga News, Transfer News, Player... latest football newsstats premier league https://www.acrosstheleagues.co.uk/ Across the Leagues - turning stats into winning bets on Premier League, Scottish Premiership,... Across the Leagues provides you with all the stats, analysis and advice you need to make money from Premier League, Scottish Premiership, Championship, League... https://www.premierleague.com/en/players/516243/joel-ndala/stats Joel Ndala Stats This Season & Career Statistics | Premier League View comprehensive stats for Nottingham Forest Forward Joel Ndala, including goals scored, assists, xG and appearances, on the official website of the Premier... joel ndalathis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/2493/peter-butler/stats Peter Butler Stats This Season & Career Statistics | Premier League View comprehensive stats for West Ham United Midfielder Peter Butler, including goals scored, assists, xG and appearances, on the official website of the... peter butlerthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/461192/kallum-cesay/overview Kallum Cesay Salford City Defender, Profile & Stats | Premier League View the player profile of Salford City Defender Kallum Cesay, including stats and videos, on the official website of the Premier League. kallum cesaysalford cityprofile statsdefenderpremier https://www.premierleague.com/en/players/1331/thierry-bonalair/overview Thierry Bonalair Nottingham Forest Midfielder, Profile & Stats | Premier League View the player profile of Nottingham Forest Midfielder Thierry Bonalair, including stats and videos, on the official website of the Premier League. thierry bonalairnottingham forestprofile statsmidfielderpremier https://www.premierleague.com/en/players/447715/aaron-ramsey/stats Aaron Ramsey Stats This Season & Career Statistics | Premier League View comprehensive stats for Burnley Midfielder Aaron Ramsey, including goals scored, assists, xG and appearances, on the official website of the Premier... aaron ramseythis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/7551/joleon-lescott/overview Joleon Lescott Sunderland Defender, Profile & Stats | Premier League View the player profile of Sunderland Defender Joleon Lescott, including stats and videos, on the official website of the Premier League. joleon lescottprofile statssunderlanddefenderpremier https://www.premierleague.com/en/players/19524/santi-cazorla/stats Santi Cazorla Stats This Season & Career Statistics | Premier League View comprehensive stats for Real Oviedo Midfielder Santi Cazorla, including goals scored, assists, xG and appearances, on the official website of the Premier... santi cazorlathis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/449327/milutin-osmajic/overview Milutin Osmajic Preston North End U21 Forward, Profile & Stats | Premier League View the player profile of Preston North End U21 Forward Milutin Osmajic, including stats and videos, on the official website of the Premier League. preston north endmilutin osmajicprofile stats https://www.premierleague.com/en/players/1323/riccardo-scimeca/overview Riccardo Scimeca Aston Villa Defender, Profile & Stats | Premier League View the player profile of Aston Villa Defender Riccardo Scimeca, including stats and videos, on the official website of the Premier League. riccardo scimecaaston villaprofile statsdefenderpremier https://www.premierleague.com/en/matchweek/2020_15/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.racingpost.com/sport/football-tips/premier-league/premier-league-key-match-stats-including-everton-v-arsenal-aVPMk1o0cgfZ/ Premier League key match stats including Everton v Arsenal | Racing Post Over 2.5 goals has landed in 15 of Manchester City's 17 Premier League games premier leaguematch statskey https://www.premierleague.com/en/players/420926/tyrhys-dolan/overview Tyrhys Dolan Blackburn Rovers Midfielder, Profile & Stats | Premier League View the player profile of Blackburn Rovers Midfielder Tyrhys Dolan, including stats and videos, on the official website of the Premier League. tyrhys dolanblackburn roversprofile statsmidfielderpremier https://www.premierleague.com/en/players/518500/daniel-murphy/overview Daniel Murphy Skelmersdale United Defender, Profile & Stats | Premier League View the player profile of Skelmersdale United Defender Daniel Murphy, including stats and videos, on the official website of the Premier League. daniel murphyskelmersdale unitedprofile statsdefenderpremier https://www.premierleague.com/en/players/179456/oskar-buur/overview Oskar Buur FC Volendam Defender, Profile & Stats | Premier League View the player profile of FC Volendam Defender Oskar Buur, including stats and videos, on the official website of the Premier League. oskar buurfc volendamprofile statsdefenderpremier https://www.premierleague.com/en/players/52117/seydou-doumbia/stats Seydou Doumbia Stats This Season & Career Statistics | Premier League View comprehensive stats for Sion Forward Seydou Doumbia, including goals scored, assists, xG and appearances, on the official website of the Premier League. seydou doumbiathis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/97032/virgil-van-dijk/overview Virgil van Dijk Liverpool Defender, Profile & Stats | Premier League View the player profile of Liverpool Defender Virgil van Dijk, including stats and videos, on the official website of the Premier League. virgil van dijkprofile statsliverpooldefenderpremier https://www.sportsmole.co.uk/football/ukrainian-premier-league/best-attack.html Ukrainian Premier League Attack stats Football - Sports Mole Attack stats in Ukrainian Premier League and other Football divisions from Sports Mole premier league attack statsukrainianfootballsportsmole https://www.premierleague.com/en/players/215065/danny-cashman/overview Danny Cashman Crawley Town Forward, Profile & Stats | Premier League View the player profile of Crawley Town Forward Danny Cashman, including stats and videos, on the official website of the Premier League. danny cashmancrawley townprofile statsforwardpremier https://www.premierleague.com/en/players/3862/vincent-candela/overview Vincent Candela Bolton Wanderers Defender, Profile & Stats | Premier League View the player profile of Bolton Wanderers Defender Vincent Candela, including stats and videos, on the official website of the Premier League. vincent candelabolton wanderersprofile statsdefenderpremier https://www.premierleague.com/en/news/4294620 Analysis: The stats behind Vardy's Premier League success Oliver Hopkins of Opta Analyst looks at the numbers behind Leicester's record-breaking striker the statspremier leagueanalysisbehindvardy https://www.premierleague.com/en/players/514229/sam-waller/overview Sam Waller Burnley U21 Goalkeeper, Profile & Stats | Premier League View the player profile of Burnley U21 Goalkeeper Sam Waller, including stats and videos, on the official website of the Premier League. sam wallerprofile statsburnleyu21goalkeeper https://www.premierleague.com/en/players/3088/gavin-mahon/stats Gavin Mahon Stats This Season & Career Statistics | Premier League View comprehensive stats for Watford Midfielder Gavin Mahon, including goals scored, assists, xG and appearances, on the official website of the Premier League. gavin mahonthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/58893/marcos-rojo/stats Marcos Rojo Stats This Season & Career Statistics | Premier League View comprehensive stats for Boca Juniors Defender Marcos Rojo, including goals scored, assists, xG and appearances, on the official website of the Premier... marcos rojothis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/477383/jaden-warner/stats Jaden Warner Stats This Season & Career Statistics | Premier League View comprehensive stats for Newport County Defender Jaden Warner, including goals scored, assists, xG and appearances, on the official website of the Premier... jaden warnerthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/474210/harry-perritt/overview Harry Perritt Alfreton Town Defender, Profile & Stats | Premier League View the player profile of Alfreton Town Defender Harry Perritt, including stats and videos, on the official website of the Premier League. harry perrittalfreton townprofile statsdefenderpremier https://www.newsbytesapp.com/news/sports/liverpool-hold-arsenal-2-2-in-premier-league-2022-23/story Liverpool hold Premier League 2022-23 leaders Arsenal 2-2: Key stats Liverpool held Premier League 2022-23 leaders Arsenal 2-2 in a crucial contest at Anfield on Sunday premier league 2022 23liverpoolhold https://www.premierleague.com/en/players/501837/yerson-mosquera/overview Yerson Mosquera Wolverhampton Wanderers Defender, Profile & Stats | Premier League View the player profile of Wolverhampton Wanderers Defender Yerson Mosquera, including stats and videos, on the official website of the Premier League. yerson mosquerawolverhampton wanderersprofile statsdefenderpremier https://www.statsperform.com/news/stats-perform-uses-ai-to-predict-final-standings-of-the-2019-20-premier-league-season/ Stats Perform uses AI to predict final standings of the 2019/20 Premier League season - Stats... https://www.premierleague.com/en/players/490155/oscar-tarensi/stats Oscar Tarensi Stats This Season & Career Statistics | Premier League View comprehensive stats for Manchester City U21 Defender Oscar Tarensi, including goals scored, assists, xG and appearances, on the official website of the... this seasoncareer statisticsoscarstatspremier https://www.premierleague.com/en/players/465387/louie-barry/overview Louie Barry Aston Villa U21 Forward, Profile & Stats | Premier League View the player profile of Aston Villa U21 Forward Louie Barry, including stats and videos, on the official website of the Premier League. aston villa u21louie barryprofile statsforwardpremier https://www.premierleague.com/en/players/49724/franco-di-santo/overview Franco Di Santo FC Schalke 04 Forward, Profile & Stats | Premier League View the player profile of FC Schalke 04 Forward Franco Di Santo, including stats and videos, on the official website of the Premier League. franco di santofc schalke 04profile stats https://www.premierleague.com/en/players/55658/marcos-angeleri/stats Marcos Angeleri Stats This Season & Career Statistics | Premier League View comprehensive stats for Sunderland Defender Marcos Angeleri, including goals scored, assists, xG and appearances, on the official website of the Premier... marcos angelerithis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/432714/james-mcatee/stats James McAtee Stats This Season & Career Statistics | Premier League View comprehensive stats for Nottingham Forest Midfielder James McAtee, including goals scored, assists, xG and appearances, on the official website of the... james mcateethis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/486622/zan-luk-leban/overview Zan-Luk Leban Everton Goalkeeper, Profile & Stats | Premier League View the player profile of Everton Goalkeeper Zan-Luk Leban, including stats and videos, on the official website of the Premier League. profile statszanluklebaneverton https://www.premierleague.com/en/players/10814/paul-bracewell/stats Paul Bracewell Stats This Season & Career Statistics | Premier League View comprehensive stats for Sunderland Midfielder Paul Bracewell, including goals scored, assists, xG and appearances, on the official website of the Premier... paul bracewellthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/636757/harry-sutherington/overview Harry Sutherington Leicester City U18 Midfielder, Profile & Stats | Premier League View the player profile of Leicester City U18 Midfielder Harry Sutherington, including stats and videos, on the official website of the Premier League. leicester cityprofile statsharryu18midfielder https://www.premierleague.com/en/players/61739/maxime-le-marchand/stats Maxime Le Marchand Stats This Season & Career Statistics | Premier League View comprehensive stats for Strasbourg Defender Maxime Le Marchand, including goals scored, assists, xG and appearances, on the official website of the... maxime le marchandthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/matchweek/2014_40/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/155651/adam-masina/overview Adam Masina Udinese Defender, Profile & Stats | Premier League View the player profile of Udinese Defender Adam Masina, including stats and videos, on the official website of the Premier League. adam masinaprofile statsudinesedefenderpremier https://www.premierleague.com/en/players/141746/bruno-miguel-borges-fernandes/overview Bruno Fernandes Manchester United Midfielder, Profile & Stats | Premier League View the player profile of Manchester United Midfielder Bruno Fernandes, including stats and videos, on the official website of the Premier League. bruno fernandesmanchester unitedprofile statsmidfielderpremier https://www.premierleague.com/en/players/174590/jacob-maddox/stats Jacob Maddox Stats This Season & Career Statistics | Premier League View comprehensive stats for Forest Green Rovers Midfielder Jacob Maddox, including goals scored, assists, xG and appearances, on the official website of the... jacob maddoxthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/108238/richard-peniket/overview Richard Peniket Alfreton Town Forward, Profile & Stats | Premier League View the player profile of Alfreton Town Forward Richard Peniket, including stats and videos, on the official website of the Premier League. richard peniketalfreton townprofile statsforwardpremier https://www.premierleague.com/en/matchweek/2024_5/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/40804/lloyd-kerry/overview Lloyd Kerry Harrogate Town Midfielder, Profile & Stats | Premier League View the player profile of Harrogate Town Midfielder Lloyd Kerry, including stats and videos, on the official website of the Premier League. lloyd kerryharrogate townprofile statsmidfielderpremier https://www.premierleague.com/en/players/221428/aidan-barlow/overview Aidan Barlow Rochdale Midfielder, Profile & Stats | Premier League View the player profile of Rochdale Midfielder Aidan Barlow, including stats and videos, on the official website of the Premier League. aidan barlowprofile statsrochdalemidfielderpremier https://www.premierleague.com/en/players/232787/conor-gallagher/overview Conor Gallagher Tottenham Hotspur Midfielder, Profile & Stats | Premier League View the player profile of Tottenham Hotspur Midfielder Conor Gallagher, including stats and videos, on the official website of the Premier League. conor gallaghertottenham hotspurprofile statsmidfielderpremier https://www.premierleague.com/en/players/87110/conor-thomas/stats Conor Thomas Stats This Season & Career Statistics | Premier League View comprehensive stats for Crewe Alexandra Midfielder Conor Thomas, including goals scored, assists, xG and appearances, on the official website of the... conor thomasthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/matchweek/2017_7/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/7185/philemon-masinga/overview Philemon Masinga Leeds United Forward, Profile & Stats | Premier League View the player profile of Leeds United Forward Philemon Masinga, including stats and videos, on the official website of the Premier League. philemon masingaleeds unitedprofile statsforwardpremier https://www.premierleague.com/en/players/444899/ethen-vaughan/overview Ethen Vaughan Burnley U21 Defender, Profile & Stats | Premier League View the player profile of Burnley U21 Defender Ethen Vaughan, including stats and videos, on the official website of the Premier League. profile statsethenvaughanburnleyu21 https://www.premierleague.com/en/matchweek/2023_18/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/70771/ahmed-abdullah/overview Ahmed Abdullah Whitehawk Midfielder, Profile & Stats | Premier League View the player profile of Whitehawk Midfielder Ahmed Abdullah, including stats and videos, on the official website of the Premier League. ahmed abdullahprofile statswhitehawkmidfielderpremier https://www.premierleague.com/en/players/518906/owen-bevan/stats Owen Bevan Stats This Season & Career Statistics | Premier League View comprehensive stats for Bournemouth Defender Owen Bevan, including goals scored, assists, xG and appearances, on the official website of the Premier... owen bevanthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/216094/jeremie-frimpong/overview Jeremie Frimpong Liverpool Defender, Profile & Stats | Premier League View the player profile of Liverpool Defender Jeremie Frimpong, including stats and videos, on the official website of the Premier League. jeremie frimpongprofile statsliverpooldefenderpremier https://www.nbcsports.com/soccer/premier-league Premier League | Soccer: News, Videos, Stats, Highlights, Results & More - NBC Sports - NBC Sports Find all the latest Premier League news, live coverage, videos, highlights, stats, predictions, and results right here on NBC Sports. premier league soccernews videos https://www.statsperform.com/resource/sequences-and-the-premier-league/ Sequences and the Premier League - Stats Perform Mar 25, 2020 - Earlier this week, Johannes Harkins introduced the Opta possessions framework. This sequence-based model focuses on going beyond analysing events in isolation,... the premier leaguesequencesstatsperform https://www.newsbytesapp.com/news/sports/premier-league-2022-23-mufc-vs-brighton-key-stats/story Premier League 2022-23, Brighton overcome Manchester United 2-1: Key stats Manchester United suffered a telling defeat in their opening Premier League 2022-23 encounter against Brighton at Old Trafford on Sunday premier league 2022 23 https://www.fourfourtwo.com/features/stats-zone-premier-league-attacking-midfielder-season-201516-mesut-ozil Stats Zone Premier League Attacking Midfielder of the Season 2015/16: Mesut Ozil | FourFourTwo May 18, 2016 - Had the German recreated his assist-providing artistry in the second half of 2015/16, we'd have been looking at the most unprecented creative campaign in the... https://www.premierleague.com/en/players/183656/josh-dasilva/stats Josh Dasilva Stats This Season & Career Statistics | Premier League View comprehensive stats for Brentford Midfielder Josh Dasilva, including goals scored, assists, xG and appearances, on the official website of the Premier... josh dasilvathis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/510328/stanley-mills/stats Stanley Mills Stats This Season & Career Statistics | Premier League View comprehensive stats for Oxford United Midfielder Stanley Mills, including goals scored, assists, xG and appearances, on the official website of the... stanley millsthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/564508/victor-musa/overview Victor Musa Manchester United U21 Forward, Profile & Stats | Premier League View the player profile of Manchester United U21 Forward Victor Musa, including stats and videos, on the official website of the Premier League. victor musamanchester unitedprofile statsu21forward https://www.premierleague.com/en/players/154050/olufela-olomola/overview Olufela Olomola Bromley Forward, Profile & Stats | Premier League View the player profile of Bromley Forward Olufela Olomola, including stats and videos, on the official website of the Premier League. olufela olomolaprofile statsbromleyforwardpremier https://www.premierleague.com/en/players/84930/joe-walsh/overview Joe Walsh Lincoln City Defender, Profile & Stats | Premier League View the player profile of Lincoln City Defender Joe Walsh, including stats and videos, on the official website of the Premier League. joe walshlincoln cityprofile statsdefenderpremier https://www.premierleague.com/en/matchweek/2018_1/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/matchweek/2014_38/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/232456/dilan-markanday/overview Dilan Markanday Chesterfield Forward, Profile & Stats | Premier League View the player profile of Chesterfield Forward Dilan Markanday, including stats and videos, on the official website of the Premier League. dilan markandayprofile statschesterfieldforwardpremier https://www.premierleague.com/en/players/55922/mark-marshall/stats Mark Marshall Stats This Season & Career Statistics | Premier League View comprehensive stats for Crawley Town Midfielder Mark Marshall, including goals scored, assists, xG and appearances, on the official website of the Premier... mark marshallthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/matchweek/2015_29/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/54917/dries-mertens/stats Dries Mertens Stats This Season & Career Statistics | Premier League View comprehensive stats for Galatasaray Forward Dries Mertens, including goals scored, assists, xG and appearances, on the official website of the Premier... dries mertensthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/55950/rhys-williams/stats Rhys Williams Stats This Season & Career Statistics | Premier League View comprehensive stats for Middlesbrough Defender Rhys Williams, including goals scored, assists, xG and appearances, on the official website of the Premier... rhys williamsthis seasoncareer statisticsstatspremier https://www.fpl.live/ FPL Live | Real-Time Stats & Rankings for Fantasy Premier League Jan 29, 2025 - Track your FPL Live rankings in real-time with FPL.Live. Download the #1 app for Fantasy Premier League live updates. real timestats rankingsfpllivefantasy https://www.premierleague.com/en/players/536375/zac-williams/overview Zac Williams Crewe Alexandra Defender, Profile & Stats | Premier League View the player profile of Crewe Alexandra Defender Zac Williams, including stats and videos, on the official website of the Premier League. zac williamscrewe alexandraprofile statsdefenderpremier https://www.premierleague.com/en/players/223541/federico-chiesa/overview Federico Chiesa Liverpool Forward, Profile & Stats | Premier League View the player profile of Liverpool Forward Federico Chiesa, including stats and videos, on the official website of the Premier League. federico chiesaprofile statsliverpoolforwardpremier https://www.premierleague.com/en/players/450534/charlie-wiggett/stats Charlie Wiggett Stats This Season & Career Statistics | Premier League View comprehensive stats for Newcastle United U21 Defender Charlie Wiggett, including goals scored, assists, xG and appearances, on the official website of the... this seasoncareer statisticscharliestatspremier https://www.premierleague.com/en/players/235257/joshua-strizovic/overview Joshua Strizovic Dagenham & Redbridge Goalkeeper, Profile & Stats | Premier League dagenham redbridgeprofile statsjoshuagoalkeeperpremier https://www.premierleague.com/en/players/49277/leroy-fer/overview Leroy Fer Alanyaspor Midfielder, Profile & Stats | Premier League View the player profile of Alanyaspor Midfielder Leroy Fer, including stats and videos, on the official website of the Premier League. leroy ferprofile statsalanyaspormidfielderpremier https://www.premierleague.com/en/players/217201/daniel-bramall/overview Daniel Bramall Scarborough Athletic Defender, Profile & Stats | Premier League View the player profile of Scarborough Athletic Defender Daniel Bramall, including stats and videos, on the official website of the Premier League. daniel bramallscarborough athleticprofile statsdefenderpremier https://www.premierleague.com/en/players/488160/charlie-webster/overview Charlie Webster Burton Albion Midfielder, Profile & Stats | Premier League View the player profile of Burton Albion Midfielder Charlie Webster, including stats and videos, on the official website of the Premier League. charlie websterburton albionprofile statsmidfielderpremier https://www.premierleague.com/en/matchweek/2018_6/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/matchweek/2008_16/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/116643/fabinho/overview Fabinho Al Ittihad Midfielder, Profile & Stats | Premier League View the player profile of Al Ittihad Midfielder Fabinho, including stats and videos, on the official website of the Premier League. al ittihadprofile statsfabinhomidfielderpremier https://www.premierleague.com/en/players/17891/diniyar-bilyaletdinov/overview Diniyar Bilyaletdinov Rubin Kazan Midfielder, Profile & Stats | Premier League View the player profile of Rubin Kazan Midfielder Diniyar Bilyaletdinov, including stats and videos, on the official website of the Premier League. diniyar bilyaletdinovrubin kazanprofile statsmidfielderpremier https://www.premierleague.com/en/players/596044/amir-ibragimov/overview Amir Ibragimov Manchester United U21 Midfielder, Profile & Stats | Premier League View the player profile of Manchester United U21 Midfielder Amir Ibragimov, including stats and videos, on the official website of the Premier League. amir ibragimovmanchester unitedprofile statsu21midfielder https://www.premierleague.com/en/players/14941/klaas-jan-huntelaar/stats Klaas Jan Huntelaar Stats This Season & Career Statistics | Premier League View comprehensive stats for Ajax Forward Klaas Jan Huntelaar, including goals scored, assists, xG and appearances, on the official website of the Premier... klaas jan huntelaarthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/2161/eyal-berkovic/overview Eyal Berkovic West Ham United Midfielder, Profile & Stats | Premier League View the player profile of West Ham United Midfielder Eyal Berkovic, including stats and videos, on the official website of the Premier League. west ham unitedeyal berkovicprofile statsmidfielderpremier https://www.premierleague.com/en/matchweek/2023_42/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/148225/anthony-martial/stats Anthony Martial Stats This Season & Career Statistics | Premier League View comprehensive stats for AEK Athens Forward Anthony Martial, including goals scored, assists, xG and appearances, on the official website of the Premier... anthony martialthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/152551/jefferson-lerma/overview Jefferson Lerma Crystal Palace Midfielder, Profile & Stats | Premier League View the player profile of Crystal Palace Midfielder Jefferson Lerma, including stats and videos, on the official website of the Premier League. jefferson lermacrystal palaceprofile statsmidfielderpremier https://www.premierleague.com/en/matchweek/2010_19/blog Premier League Live Scores, Stats & Blog | 2025/26 premier league live scoresstatsblog202526 https://www.premierleague.com/en/players/519507/adam-vyse/stats Adam Vyse Stats This Season & Career Statistics | Premier League this seasoncareer statisticsadamvysestats https://www.premierleague.com/en/players/226944/boubacar-kamara/overview Boubacar Kamara Aston Villa U21 Midfielder, Profile & Stats | Premier League View the player profile of Aston Villa U21 Midfielder Boubacar Kamara, including stats and videos, on the official website of the Premier League. aston villa u21boubacar kamaraprofile statsmidfielderpremier https://www.premierleague.com/en/players/461421/lewis-dobbin/overview Lewis Dobbin Aston Villa Forward, Profile & Stats | Premier League View the player profile of Aston Villa Forward Lewis Dobbin, including stats and videos, on the official website of the Premier League. lewis dobbinaston villaprofile statsforwardpremier https://www.premierleague.com/en/players/220483/george-miller/stats George Miller Stats This Season & Career Statistics | Premier League View comprehensive stats for Cheltenham Town Forward George Miller, including goals scored, assists, xG and appearances, on the official website of the Premier... george millerthis seasoncareer statisticsstatspremier https://www.premierleague.com/en/players/6367/scott-taylor/overview Scott Taylor Leicester City Midfielder, Profile & Stats | Premier League View the player profile of Leicester City Midfielder Scott Taylor, including stats and videos, on the official website of the Premier League. scott taylorleicester cityprofile statsmidfielderpremier