https://takt.inc/case-study/stryve/
Stryve | Takt | Brand + Digital Agency
Jan 30, 2025 - Read our website design + development and brand strategy for Stryve Fitness, a leader in home fitness solutions.
brand digitalstryvetaktagency
https://www.stryvemarketing.com/blog/esports/
What is eSports and why should you care? | Stryve Digital Marketing
Dec 13, 2024 - Unsure of what eSports is and why it matters? This deck explains the basics of eSports, and why marketers should be paying attention.
why should you carewhat isesports
https://www.stryve.com.au/first-home-grants-schemes/family-home-guarantee-scheme
Family Home Guarantee Scheme for Single Parents | Stryve
Learn how single parents can buy a home with just 2% deposit under the Family Home Guarantee Scheme. Stryve Finance helps you apply with ease and confidence
home guarantee schemefor single parentsfamilystryve
https://www.stryvemarketing.com/blog/is-social-media-a-fad/
Is Social Media a Fad? | Stryve Digital Marketing
social mediafadstryvedigitalmarketing
https://www.stryvemarketing.com/blog/category/work-life/page/6/
Work Life Archives | Page 6 of 109 | Stryve Digital Marketing
Work smarter, not harder right? We discuss all the things that make Stryve a great place to work.
work lifearchives pagestryvedigitalmarketing
https://www.stryvemarketing.com/blog/create-your-own-type-with-prototypo/
Create your own type with Prototypo | Stryve Digital Marketing
Apr 4, 2023 - Designers spend hours searching for the perfect font. With Prototypo you have the flexibility to create your own and use them wherever you want.
create your owntypestryvedigitalmarketing
https://www.stryvemarketing.com/blog/category/marketing/page/20/
Marketing Archives | Page 20 of 254 | Stryve Digital Marketing
The latest news, tips and tricks for B2B Digital Marketing.
marketing archivesstryvedigital
https://www.stryve.com.au/how-to-buy-a-home/application-checklist
Application Checklist | Stryve
Use this complete home loan application checklist for 2025. Learn what documents you need, when to prepare them, and how to get approved faster.
application checkliststryve
https://stryve.com/
Stryve Protein Snacks
Eat steak, don't be a jerky! Enjoy all-natural, keto-friendly beef snacks.
stryveproteinsnacks
https://www.stryvechiropractic.com/
Stryve Spine + Sport
Experience the benefits of an individual and personalized treatment experience. Stryve is a contemporary practice tailored specifically in the interest of...
stryvespinesport
https://www.stryvemarketing.com/work/sentinel-vac-pack/
Sentinel: Creating a compelling value analysis committee package | Stryve Digital Marketing
Feb 12, 2026 - Sentinel tasked Stryve to create and design a value analysis committee package (VAC pack) to improve their sales engagements with hospitals.
value analysissentinelcreatingcompelling
https://www.stryvemarketing.com/blog/casl-compliance/
Avoid fines with these CASL compliance best practices | Stryve
Feb 24, 2026 - With fines being levied and changes to CASL on the way, companies need to shape up and ensure compliance when it comes to user data, privacy, and consent.
compliance best practiceswith theseavoidfinescasl
https://www.stryvemarketing.com/work/gemini-branding-new-air-charged-catheter/
Gemini: Branding a new air-charged catheter | Stryve Digital Marketing
Feb 12, 2026 - Gemini tasked Stryve with naming and creating a visual identity for their cutting-edge air-charged urodynamics catheter.
a newgeminibrandingaircharged
https://www.stryvemarketing.com/
B2B Digital Marketing & Design Agency in Kitchener-Waterloo | Stryve
Feb 4, 2025 - B2B marketing doesn't have to be boring to be effective. Your B2B digital marketing agency needs to deliver on strategy, creativity, and technology.
digital marketingdesign agencykitchener waterloostryve