https://www.usgs.gov/publications/a-reconnaissance-study-radon-levels-soils-developed-upper-cretaceous-pierre-shale-just
No abstract available.
reconnaissancestudyradonlevelssoils
https://www.marijuanamoment.net/the-soil-cannabis-is-grown-in-affects-thc-cbd-and-terpene-levels-federally-funded-study-shows/
Oct 8, 2025 - Bioactive compounds in cannabis are significantly impacted by the chemical composition of the soil the plants are grown in, according to a new federally funded...
soilcannabisgrownaffectsthc
https://www.sciencedaily.com/releases/2011/12/111201174225.htm
A drop in carbon dioxide appears to be the driving force that led to the Antarctic ice sheet's formation, according to a recent study of molecules from ancient...
carbon dioxide levelspolar ice sheetdropled
https://www.techtimes.com/articles/228183/20180521/study-shows-people-with-higher-levels-of-belly-fat-could-suffer-from-vitamin-d-deficiency.htm
Obesity and vitamin D deficiency could be linked according to a new study. The study showed that men and women who had higher levels of fat around their...
higher levelsbelly fatstudyshowspeople
https://www.ajmc.com/view/study-finds-inverse-relationship-between-osa-male-testosterone-levels
An inverse relationship between obstructive sleep apnea (OSA) and serum testosterone was found in men, in which those with severe cases of OSA exhibited...
study findsinverse relationshipmale testosteroneosalevels
https://pubmed.ncbi.nlm.nih.gov/32862087/
Besides confirming the association with lipids in the whole group, our study revealed previously unknown differences in PCSK9 predictors in men and women....
european populationsexspecificpredictorslevels
https://www.indiatimes.com/technology/news/moon-has-hazardous-radiation-levels-putting-future-astronauts-at-risk-of-cancer-warns-study/articleshow/127682729.html
A new study maps the radiation levels on the Moon and warns that such levels can prove seriously lethal for future astronauts visiting the Earth's natural...
radiation levelsmoonhazardousputtingfuture
https://www.asiaone.com/lifestyle/new-study-links-high-levels-oestrogen-womb-autism
For the first time, new European research has found a link between high levels of oestrogen sex hormones in the womb and an increased risk of developing...
new studyhigh levelslinksoestrogenwomb
https://www.news-medical.net/news/20160727/Study-finds-link-between-vitamin-D-levels-and-risk-of-cognitive-decline-in-Chinese-elderly.aspx
This study asks similar questions of vitamin D levels and cognition in the Chinese elderly. It is the first large-scale prospective study in Asia to study the...
study findsvitaminlevelsrisk
https://www.christianpost.com/news/franklin-graham-matt-chandler-sound-warnings-study-reveals-epidemic-levels-loneliness.html
A number of American pastors have spoken out as a major study released by a global insurance company last week found that U.S. citizens face "epidemic" levels...
franklin grahammatt chandlersoundwarningsstudy
https://psmag.com/environment/dangers-fracking-new-study-finds-high-levels-arsenic-groundwater-65094/
A Q&A with Brian Fontenot, whose research gives the latest indication that fracking may be tied to arsenic contamination.
new studyhigh levelsdangersfrackingfinds
https://www.spacedaily.com/reports/Toxic_levels_of_arsenic_in_Amazon_basin_well_water_study_999.html
Vienna (AFP) April 12, 2018 - Shallow wells dug for drinking water in the Amazon basin in order to avoid polluted rivers contain up to 70 times the recommended...
amazon basinwell watertoxiclevelsarsenic
https://www.oralhealthgroup.com/clinical/dental-research/pregnancy-stress-hormones-may-shape-when-a-childs-first-teeth-appear-study-finds-1003991883/
Nov 21, 2025 - Pregnancy stress hormones may shape child’s first teeth, new research shows with cortisol showing the strongest association.
baby teethingcortisollevelspregnancytied
https://www.windsor-forest.ac.uk/t-levels-3/
May 22, 2025 - T Levels provide technical expertise for future careers, designed with industry collaboration to meet evolving sector needs. Apply today to get started.
study levelscoursescollege
https://www.healthday.com/healthpro-news/environmental-health/arsenic-less-than-epa-maximum-contaminant-level-tied-to-adverse-birth-outcomes
Arsenic measured in public water systems at levels below the current U.S. Environmental Protection Agency's maximum contaminant level are associated with...
low levelsstudy findsarsenicimpactlinked
https://experiment.com/projects/are-pollutant-levels-changing-in-marine-life-a-case-study-of-metal-levels-in-whales-in-the-sea-of-cortez
Experiment is an online platform for funding and sharing scientific discoveries. Push the boundaries of knowledge in biology, chemistry, medicine, physics,...
marine lifecase studypollutantlevelschanging
https://www.sciencedaily.com/releases/2001/06/010619072635.htm
A published study of hormonal changes in a group of Canadian men becoming fathers for the first time showed a decrease in testosterone and cortisol levels and...
study findschangeshormonelevelsmen
https://hku.hk/press/press-releases/detail/21687.html
Edward Moncreiffe, HK Chief Executive Officer, HSBC Life (left), Dr Vivian Lou, Director, Sau Po Centre on Ageing, The University of Hong Kong (middle) and...
working caregivershigh levelsexperiencedstress
https://www.heraldnet.com/news/hood-canal-oxygen-levels-cyclical-says-study/
BREMERTON - Deposits at the bottom of Hood Canal suggest a natural cycle of high and low oxygen levels, and the last 50 years have been on the high side...
hood canaloxygen levelscyclicalsaysstudy
https://www.sciencedaily.com/releases/2005/05/050525161319.htm
A group of researchers from Israel has discovered that rats exhibiting the signs of depression have increased levels of the omega-6 fatty acid, arachidonic...
study linksfatty acidbrainlevelsdepression
https://www.kjzz.org/2018-07-19/content-673273-study-ozone-levels-impact-national-park-attendance
A new study is finding that ozone concentrations in national parks are similar to those of our country's major metropolitan areas. Researchers found that on...
national parkstudyozonelevelsimpact
https://pubmed.ncbi.nlm.nih.gov/1930358/
An experimental evaluation of citrulline malate (Stimol, CAS 54940-97-5), an anti-fatigue compound, was undertaken in man and in the animal in order to study...
citrulline malateacid baseactivitybalanceblood
https://www.downtoearth.org.in/health/study-finds-high-arsenic-levels-in-staple-foods-in-11-bihar-districts-links-it-to-groundwater-contamination
A recent study from Mahavir Cancer Sansthan and Research Centre in Patna reveals alarming arsenic levels in staple foods across 11 Bihar districts, linking it...
staple foodsstudyrevealshigharsenic
https://www.prweb.com/releases/testosterone_lawsuit_news_bernstein_liebhard_llp_notes_new_study_suggesting_that_hormone_levels_may_not_boost_athletic_ability/prweb12366536.htm
New York, NY (PRWEB) December 02, 2014 -- As testosterone lawsuits (http://www.testosteronelawsuithub.com/) continue to move forward in U.S. courts,...
testosterone lawsuitnew studynewsbernsteinllp
https://digitalmarketinginstitute.com/students/courses?utm_source=organic_webinar&utm_medium=organic_webinar&utm_campaign=trends_webinar_2023_students_courses
Globally accredited digital marketing courses designed, taught and validated by industry leaders including Google, Facebook, and LinkedIn. Enroll now at DMI.
digital marketing coursesflexible studyonlinelevelsdmi
https://pubmed.ncbi.nlm.nih.gov/38320121/
Coagulation factor VIII (FVIII) and its carrier protein von Willebrand factor (VWF) are critical to coagulation and platelet aggregation. We leveraged...
genetic association studycoagulation factor viii
https://www.news-medical.net/news/20240808/Bran-enriched-corn-flour-lowers-LDL-cholesterol-in-adults-with-elevated-levels-study-finds.aspx
Study found that bran-enriched corn flour significantly reduces LDL cholesterol levels in adults with elevated cholesterol, while having minimal impact on gut...
corn flourldl cholesterolbranenrichedlowers
https://pubmed.ncbi.nlm.nih.gov/31543086/?dopt=Abstract
It is important to consider individual lipid levels and demographic characteristics when investigating associations between cholesterol levels and cognition in...
associationslipidlevelscognitionfindings
https://www.foxweather.com/earth-space/greenland-melting-ice-to-raise-global-sea-levels
Startling new research suggests that ice is melting much faster than originally thought in Greenland, leading to a global sea level rise by at least 10 inches.
gravityweakeningmeltingicegreenland
https://www.sciencetimes.com/articles/41794/20230111/air-quality-subway-stations-near-river-tunnels-higher-levels-hazardous.htm
Commuters of subway stations near rivers are exposed to higher concentrations of air pollutants than other stations. Read the article to know more about the...
air qualitysubwaystationsnearriver
https://www.frontiersin.org/journals/marine-science/articles/10.3389/fmars.2021.671319/full
Diego Garcia is the largest atoll within the Chagos Archipelago in the Indian Ocean. Since the 1960s it has been a military base, populated only by military ...
marine water qualitydiego garciafrontierspreliminarystudy
https://www.fatherly.com/news/how-blood-sugar-cholesterol-at-35-predict-risk-dementia
A study has found a link between you blood sugar and cholesterol levels at 35 and your likelihood of developing Alzheimer's later on.
blood sugarcholesterol levelsstudylinkeddementia
https://www.sciencedaily.com/releases/2022/11/221101152002.htm
Adults with hypertension saw a small, but consequential, rise in their blood pressure levels during the first eight months of the COVID-19 pandemic, while the...
blood pressurelevelsrosepandemicstudy
https://www.utoronto.ca/news/u-t-led-study-finds-link-between-adhd-symptoms-and-high-fluoride-levels-during-pregnancy?utm_source=U+of+T+News+-+Published+Today&utm_campaign=e4106beb32-EMAIL_CAMPAIGN_2018_01-10_COPY_01&utm_medium=email&utm_term=0_075647550f-e4106beb32-109883169
Higher levels of urinary fluoride during pregnancy are associated with more ADHD-like symptoms in school-age children as reported by parents, according to a...
study findsledadhdlike
https://www.techtimes.com/articles/4749/20140324/like-mother-like-daughter-or-son-study-links-maternal-physical-activity-levels-to-childs.htm
A new study published in Pediatrics has linked a mother's level of physical activity to that of their child, with more active mothers have more active...
mother daughterstudy findslikesonparallels
https://www.motherjones.com/environment/2025/05/toxic-pesticide-levels-found-in-tampons-glyphosate/
Glyphosate, an herbicide linked to cancer, is also abundant in the United States.
study findshigh levelsrounduptypeweedkiller
https://www.marketingdive.com/news/tag-certified-channels-reduce-fraud-levels-by-more-than-83-new-study-says/512557/
The 614 Group analyzed more than 6.5 billion display and video impressions for its research with agency partners GroupM, IPG Mediabrands and Horizon Media.
tag certifiedreduce fraudchannelslevels
https://www.news-medical.net/news/20221010/Consuming-water-with-fluoride-at-levels-used-for-public-supplies-is-safe-study-reassures.aspx
Research from The University of Queensland has found no link between community water fluoridation and adverse effects on children's brain development.
consumingwaterfluoridelevelsused
https://experiment.com/projects/are-pollutant-levels-changing-in-marine-life-a-case-study-of-metal-levels-in-whales-in-the-sea-of-cortez/labnotes
Experiment is an online platform for funding and sharing scientific discoveries. Push the boundaries of knowledge in biology, chemistry, medicine, physics,...
marine lifecase studypollutantlevelschanging
https://www.sciencedaily.com/releases/2024/08/240821124210.htm
A recent study explored one possible cause -- hyperoxia or high concentrations of oxygen given to such patients during surgery -- as opposed to doses more...
low oxygen levelsheart surgeryhighsafe
https://xtremepape.rs/threads/material-to-get-a-in-islamiat-pak-study-and-urdu-as-second-language-in-o-levels.52207/
Hello guys !! this year i completed my o levels . then i thought of creating this thread to help all who need urgent help to get A* in these 3 subjects...
pak studymaterialgetislamiaturdu
https://www.cancerresearchuk.org/about-cancer/find-a-clinical-trial/a-study-looking-at-x-ray-mammography-and-mri-in-women-at-different-levels-of-risk-of-developing-1
This study is for premenopausal women aged 39.5 to 50.5 years who have healthy breast tissue on a mammogram.
x raystudylookingmammographymri
https://www.natureworldnews.com/articles/37386/20170418/13-1-million-people-displaced-rising-sea-levels-study-suggests.htm
Mass migration induced by the rising ocean waters could reshape the population distribution in the United States.
millionpeoplecoulddisplacedrising
https://pubmed.ncbi.nlm.nih.gov/30698716/
A person's lipid profile is influenced by genetic variants and alcohol consumption, but the contribution of interactions between these exposures has not been...
genome wide associationstudylipidlevelsgene
https://xerces.org/blog/study-finds-high-levels-of-pesticides-in-wild-bees-foraging-in-farmland
A new study from USGS greatly expands our understanding of the level to which to native bees foraging in agricultural fields and nearby grasslands may be...
study findshigh levelswild beespesticidesforaging
https://www.sciencedaily.com/releases/2017/04/170419093359.htm
Women of childbearing age living in four Pacific Island countries have elevated levels of mercury in their bodies, a new study reveals.
child bearingelevatedlevelsmercurywomen
https://pubmed.ncbi.nlm.nih.gov/30670697/
Many genetic loci affect circulating lipid levels, but it remains unknown whether lifestyle factors, such as physical activity, modify these genetic effects....
blood lipidmultiancestrystudylevels
https://www.pearson.com/channels/organic-chemistry/asset/666e45a4/following-the-instructions-for-drawing-the-energy-levels-of-the-molecular-orbita-1
Following the instructions for drawing the energy levels of the molecular orbitals for the compounds shown in [Figure 8.17], draw the energy levels of the...
energy levelsfollowinginstructionsdrawing
https://www.sciencedaily.com/releases/2008/04/080430202832.htm
Popular wisdom says that aircraft provide the perfect environment for spreading disease, but few studies exist to confirm or deny this suspicion. Now, a team...
low riskbacterialevelsaircraftshows
https://www.bulletproof.com/diet-articles/keto/study-shows-coffee-in-the-morning-increases-ketone-levels/
A Canadian study showed that drinking coffee in the morning will not only keep you in a fasted state but increase your blood ketones to help you burn fat.
studyshowscoffeemorningincreases
https://www.accaglobal.com/ie/en/student/your-study-options/studyhub/hub-support/acca-study-hub-chapter-structure-and-confidence-levels.html?cq_ck=1600886986688
How to rate your confidence as you work through the chapters
study hubchapter structureaccaconfidencelevels
https://menafn.com/1110244177/Study-Reveals-Levels-Of-Age-Discrimination-In-Swiss-Workplace
Study Reveals Levels Of Age Discrimination In Swiss Workplace. Older workers continue to face discrimination in the workplace in Switzerland. According to a...
age discriminationstudyrevealslevelsswiss
https://pubmed.ncbi.nlm.nih.gov/31841749/
Our findings suggest that low folate level in psychotic METH users does not correlate with previously established risk factors for meth-induced psychosis such...
lowerfolatelevelsmethamphetamineinduced